Detailed information    

insolico Bioinformatically predicted

Overview

Name   pptA   Type   Regulator
Locus tag   DDV21_RS10435 Genome accession   NZ_CP031733
Coordinates   2165090..2165815 (-) Length   241 a.a.
NCBI ID   WP_116878128.1    Uniprot ID   A0A372KNN5
Organism   Streptococcus chenjunshii strain Z15     
Function   export ComS (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2110822..2166591 2165090..2165815 within 0


Gene organization within MGE regions


Location: 2110822..2166591
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDV21_RS10125 (DDV21_010125) essC 2110822..2115231 (-) 4410 WP_116878184.1 type VII secretion protein EssC -
  DDV21_RS10130 (DDV21_010130) essB 2115250..2116470 (-) 1221 WP_116878183.1 type VII secretion protein EssB -
  DDV21_RS10135 (DDV21_010135) - 2116454..2116705 (-) 252 WP_116878182.1 EsaB/YukD family protein -
  DDV21_RS10140 (DDV21_010140) essA 2116708..2117181 (-) 474 WP_116878181.1 type VII secretion protein EssA -
  DDV21_RS10145 (DDV21_010145) esaA 2117178..2120435 (-) 3258 WP_116878180.1 type VII secretion protein EsaA -
  DDV21_RS10150 (DDV21_010150) - 2120507..2120797 (-) 291 WP_116878179.1 WXG100 family type VII secretion target -
  DDV21_RS10155 (DDV21_010155) - 2121239..2121802 (-) 564 WP_241964671.1 GNAT family N-acetyltransferase -
  DDV21_RS11790 - 2121839..2122009 (-) 171 WP_162886311.1 hypothetical protein -
  DDV21_RS10165 (DDV21_010165) - 2122254..2122913 (-) 660 WP_162886312.1 GH25 family lysozyme -
  DDV21_RS10170 (DDV21_010170) - 2122897..2124033 (-) 1137 WP_116878175.1 CHAP domain-containing protein -
  DDV21_RS10175 (DDV21_010175) - 2124037..2124378 (-) 342 WP_116878174.1 phage holin -
  DDV21_RS10180 (DDV21_010180) - 2124388..2124684 (-) 297 WP_116878173.1 hypothetical protein -
  DDV21_RS10185 (DDV21_010185) - 2124693..2124923 (-) 231 WP_116878172.1 hypothetical protein -
  DDV21_RS10190 (DDV21_010190) - 2124889..2125284 (-) 396 WP_116878171.1 DUF1366 domain-containing protein -
  DDV21_RS10195 (DDV21_010195) - 2125316..2127304 (-) 1989 WP_241964672.1 DUF859 family phage minor structural protein -
  DDV21_RS10200 (DDV21_010200) - 2127304..2130720 (-) 3417 WP_116878170.1 glucosaminidase domain-containing protein -
  DDV21_RS10205 (DDV21_010205) - 2130721..2132226 (-) 1506 WP_116878169.1 distal tail protein Dit -
  DDV21_RS10210 (DDV21_010210) - 2132214..2136230 (-) 4017 WP_241964673.1 phage tail tape measure protein -
  DDV21_RS12005 - 2136270..2136395 (-) 126 WP_259293363.1 hypothetical protein -
  DDV21_RS10215 (DDV21_010215) - 2136461..2136760 (-) 300 WP_116878167.1 hypothetical protein -
  DDV21_RS10220 (DDV21_010220) - 2136819..2137397 (-) 579 WP_116878166.1 major tail protein -
  DDV21_RS10225 (DDV21_010225) - 2137416..2137796 (-) 381 WP_241964674.1 hypothetical protein -
  DDV21_RS10230 (DDV21_010230) - 2137789..2138187 (-) 399 WP_116878165.1 hypothetical protein -
  DDV21_RS10235 (DDV21_010235) - 2138180..2138539 (-) 360 WP_116878164.1 phage head-tail adapter protein -
  DDV21_RS11795 - 2138517..2138681 (-) 165 WP_162886313.1 hypothetical protein -
  DDV21_RS10240 (DDV21_010240) - 2138671..2138955 (-) 285 WP_116878163.1 phage gp6-like head-tail connector protein -
  DDV21_RS10245 (DDV21_010245) - 2138960..2140087 (-) 1128 WP_116878162.1 phage major capsid protein -
  DDV21_RS10250 (DDV21_010250) - 2140105..2140827 (-) 723 WP_116878161.1 head maturation protease, ClpP-related -
  DDV21_RS10255 (DDV21_010255) - 2140817..2141971 (-) 1155 WP_116878160.1 phage portal protein -
  DDV21_RS10260 (DDV21_010260) - 2142037..2142468 (-) 432 WP_116878159.1 hypothetical protein -
  DDV21_RS10265 (DDV21_010265) - 2142498..2144138 (-) 1641 WP_116878158.1 terminase TerL endonuclease subunit -
  DDV21_RS10270 (DDV21_010270) - 2144135..2144437 (-) 303 WP_116878157.1 P27 family phage terminase small subunit -
  DDV21_RS10275 (DDV21_010275) - 2144594..2144911 (-) 318 WP_116878187.1 HNH endonuclease -
  DDV21_RS10280 (DDV21_010280) - 2145745..2146171 (-) 427 Protein_1959 ArpU family phage packaging/lysis transcriptional regulator -
  DDV21_RS10285 (DDV21_010285) - 2146344..2146598 (-) 255 WP_116878155.1 hypothetical protein -
  DDV21_RS10290 (DDV21_010290) - 2146561..2146857 (-) 297 WP_116878154.1 hypothetical protein -
  DDV21_RS10295 (DDV21_010295) - 2146929..2147324 (-) 396 WP_116878153.1 YopX family protein -
  DDV21_RS10300 (DDV21_010300) - 2147336..2147608 (-) 273 WP_142917738.1 hypothetical protein -
  DDV21_RS10305 (DDV21_010305) - 2147718..2148368 (-) 651 WP_116878151.1 hypothetical protein -
  DDV21_RS10310 (DDV21_010310) - 2148361..2148606 (-) 246 WP_116878150.1 DUF3310 domain-containing protein -
  DDV21_RS10315 (DDV21_010315) - 2148596..2148829 (-) 234 WP_116878149.1 hypothetical protein -
  DDV21_RS10320 (DDV21_010320) ssb 2148857..2149129 (-) 273 Protein_1967 single-stranded DNA-binding protein -
  DDV21_RS10325 (DDV21_010325) - 2149463..2150797 (-) 1335 WP_241964675.1 virulence-associated E family protein -
  DDV21_RS10330 (DDV21_010330) - 2150794..2151615 (-) 822 WP_116878147.1 bifunctional DNA primase/polymerase -
  DDV21_RS10335 (DDV21_010335) - 2151627..2152133 (-) 507 WP_116878146.1 hypothetical protein -
  DDV21_RS10340 (DDV21_010340) - 2152153..2152929 (-) 777 WP_116878145.1 AAA family ATPase -
  DDV21_RS10345 (DDV21_010345) - 2152930..2154123 (-) 1194 WP_116878144.1 DEAD/DEAH box helicase family protein -
  DDV21_RS11965 - 2154086..2154553 (-) 468 WP_241964676.1 hypothetical protein -
  DDV21_RS10355 (DDV21_010355) - 2154550..2154915 (-) 366 WP_116878143.1 hypothetical protein -
  DDV21_RS10360 (DDV21_010360) - 2154915..2155397 (-) 483 WP_116878142.1 siphovirus Gp157 family protein -
  DDV21_RS10365 (DDV21_010365) - 2155400..2155591 (-) 192 WP_116878141.1 hypothetical protein -
  DDV21_RS10370 (DDV21_010370) - 2155594..2155827 (-) 234 WP_116878140.1 hypothetical protein -
  DDV21_RS11800 - 2155837..2155980 (-) 144 WP_162886314.1 hypothetical protein -
  DDV21_RS10375 (DDV21_010375) - 2155982..2156260 (-) 279 WP_116878139.1 DNA-binding protein -
  DDV21_RS12010 - 2156343..2156477 (-) 135 WP_259293361.1 hypothetical protein -
  DDV21_RS10380 (DDV21_010380) - 2156528..2156713 (+) 186 WP_116878138.1 hypothetical protein -
  DDV21_RS11805 - 2156743..2156910 (-) 168 WP_162886315.1 hypothetical protein -
  DDV21_RS11810 - 2156930..2157070 (-) 141 WP_162886316.1 hypothetical protein -
  DDV21_RS10385 (DDV21_010385) - 2157081..2157308 (-) 228 WP_116878137.1 helix-turn-helix domain-containing protein -
  DDV21_RS10390 (DDV21_010390) - 2157352..2157537 (-) 186 WP_116878136.1 helix-turn-helix transcriptional regulator -
  DDV21_RS10395 (DDV21_010395) - 2157687..2158544 (+) 858 WP_162886317.1 Abi-alpha family protein -
  DDV21_RS11815 - 2158723..2158887 (-) 165 WP_162886318.1 hypothetical protein -
  DDV21_RS10400 (DDV21_010400) - 2159273..2160019 (+) 747 WP_241964677.1 XRE family transcriptional regulator -
  DDV21_RS10405 (DDV21_010405) - 2160039..2160929 (+) 891 WP_116878133.1 Abi family protein -
  DDV21_RS10410 (DDV21_010410) - 2161195..2162265 (+) 1071 WP_116878132.1 site-specific integrase -
  DDV21_RS10420 (DDV21_010420) trmB 2162550..2163188 (-) 639 WP_116878131.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  DDV21_RS10425 (DDV21_010425) - 2163188..2163979 (-) 792 WP_116878130.1 phosphotransferase family protein -
  DDV21_RS10430 (DDV21_010430) - 2164051..2165088 (-) 1038 WP_116878129.1 ABC transporter permease -
  DDV21_RS10435 (DDV21_010435) pptA 2165090..2165815 (-) 726 WP_116878128.1 ABC transporter ATP-binding protein Regulator
  DDV21_RS10440 (DDV21_010440) - 2165888..2166307 (+) 420 WP_116878127.1 HIT family protein -
  DDV21_RS10445 (DDV21_010445) - 2166304..2166591 (+) 288 WP_116878126.1 chemotaxis protein -

Sequence

Protein


Download         Length: 241 a.a.        Molecular weight: 26835.96 Da        Isoelectric Point: 4.7763

>NTDB_id=310860 DDV21_RS10435 WP_116878128.1 2165090..2165815(-) (pptA) [Streptococcus chenjunshii strain Z15]
MLKIENVTGGYSHLPVLKNVSFSVSSGELLGLIGLNGAGKSTTINEIIGLLTPFQGQISIDGLTLDQDQTAYRKKIGFIP
ETPSLYEELTLKEHLEITAMAYDMDTDEALRRAQRYLELFRLEDKLDWFPSRFSKGMKQKVMIICAFLIDPDLFIFDEPF
LGLDPLAIADLSQLLADEKAKGKSILMSTHVLDSAERMCDRFVILHKGEVRASGTLSALRGQFGDDRASLNDIYVALTKE
V

Nucleotide


Download         Length: 726 bp        

>NTDB_id=310860 DDV21_RS10435 WP_116878128.1 2165090..2165815(-) (pptA) [Streptococcus chenjunshii strain Z15]
ATGTTAAAAATTGAGAATGTTACAGGCGGATACAGCCACCTTCCTGTCTTAAAAAATGTTTCTTTTTCAGTCAGCTCTGG
AGAATTGCTGGGTTTGATCGGCTTAAATGGGGCTGGGAAGTCTACAACAATTAATGAAATTATCGGGCTTTTGACGCCTT
TTCAGGGGCAGATCAGTATTGACGGACTGACTTTGGATCAGGATCAGACTGCTTATCGGAAAAAAATCGGCTTTATTCCT
GAAACTCCCAGCCTCTACGAAGAATTAACTTTGAAGGAACATCTGGAAATAACAGCTATGGCATACGATATGGATACAGA
TGAGGCGCTGAGACGGGCTCAGAGATACTTGGAACTTTTCCGCTTAGAGGATAAACTGGATTGGTTCCCCAGCCGTTTTT
CTAAGGGAATGAAGCAAAAAGTGATGATTATCTGTGCTTTTTTGATTGACCCTGATTTATTTATTTTTGATGAACCTTTT
TTGGGACTAGATCCTTTGGCAATTGCTGACCTGAGTCAGCTGCTTGCTGATGAAAAAGCAAAAGGAAAATCCATTTTGAT
GAGTACGCATGTTTTGGATTCTGCGGAAAGAATGTGTGATCGTTTTGTGATTCTGCATAAAGGGGAAGTCCGTGCCTCAG
GGACCCTGTCGGCGCTTCGCGGACAATTCGGGGATGACCGGGCGAGCCTGAATGATATTTATGTCGCTTTAACAAAAGAG
GTGTAG

Domains

Predicted by InterproScan.

ABC transporter (ABC_tran)

(17-160)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A372KNN5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pptA Streptococcus salivarius strain HSISS4

74.477

99.17

0.739
  pptA Streptococcus thermophilus LMD-9

73.222

99.17

0.726

Multiple sequence alignment