Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DXX91_RS14980 Genome accession   NZ_CP031424
Coordinates   3008872..3009012 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain B-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3003872..3014012
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXX91_RS14955 - 3004214..3004597 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  DXX91_RS14960 comA 3004619..3005263 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  DXX91_RS14965 - 3005344..3007634 (-) 2291 Protein_2868 histidine kinase -
  DXX91_RS14970 comX 3007646..3007810 (-) 165 WP_007613432.1 competence pheromone ComX -
  DXX91_RS14975 - 3007810..3008688 (-) 879 WP_024085740.1 polyprenyl synthetase family protein -
  DXX91_RS14980 degQ 3008872..3009012 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DXX91_RS14985 - 3009478..3009819 (+) 342 WP_014305721.1 hypothetical protein -
  DXX91_RS14990 - 3009826..3011046 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  DXX91_RS14995 - 3011176..3012642 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  DXX91_RS15000 - 3012660..3013211 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  DXX91_RS15005 - 3013308..3013706 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=306705 DXX91_RS14980 WP_003152043.1 3008872..3009012(-) (degQ) [Bacillus velezensis strain B-4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=306705 DXX91_RS14980 WP_003152043.1 3008872..3009012(-) (degQ) [Bacillus velezensis strain B-4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment