Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   DXX91_RS12020 Genome accession   NZ_CP031424
Coordinates   2459779..2459952 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain B-4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2454779..2464952
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXX91_RS12005 gcvT 2455597..2456697 (-) 1101 WP_044053463.1 glycine cleavage system aminomethyltransferase GcvT -
  DXX91_RS12010 - 2457120..2458790 (+) 1671 WP_003153107.1 SNF2-related protein -
  DXX91_RS12015 - 2458808..2459602 (+) 795 WP_003153106.1 YqhG family protein -
  DXX91_RS12020 sinI 2459779..2459952 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  DXX91_RS12025 sinR 2459986..2460321 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DXX91_RS12030 - 2460369..2461154 (-) 786 WP_003153102.1 TasA family protein -
  DXX91_RS12035 - 2461218..2461802 (-) 585 WP_012117977.1 signal peptidase I -
  DXX91_RS12040 tapA 2461774..2462445 (-) 672 WP_115996533.1 amyloid fiber anchoring/assembly protein TapA -
  DXX91_RS12045 - 2462704..2463033 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DXX91_RS12050 - 2463073..2463252 (-) 180 WP_003153093.1 YqzE family protein -
  DXX91_RS12055 comGG 2463309..2463686 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  DXX91_RS12060 comGF 2463687..2464082 (-) 396 WP_115996535.1 competence type IV pilus minor pilin ComGF -
  DXX91_RS12065 comGE 2464096..2464410 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  DXX91_RS12070 comGD 2464394..2464831 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=306684 DXX91_RS12020 WP_003153105.1 2459779..2459952(+) (sinI) [Bacillus velezensis strain B-4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=306684 DXX91_RS12020 WP_003153105.1 2459779..2459952(+) (sinI) [Bacillus velezensis strain B-4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment