Detailed information NTG0305908

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: DV179_RS14675
• Genome accession: NZ_CP031331
• Coordinates: 2169885..2170013 (-)
• Length: 42 a.a.
• NCBI ID: WP_306821904.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain M26263
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2164885..2175013

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DV179_RS12980	pilC	2166889..2169918 (-)	3030	WP_322114704.1	PilC family type IV pilus tip adhesin	Machinery gene
DV179_RS14675	pilC	2169885..2170013 (-)	129	WP_306821904.1	hypothetical protein	Machinery gene
DV179_RS12990	apbC	2170815..2171894 (-)	1080	WP_024465095.1	iron-sulfur cluster carrier protein ApbC	-
DV179_RS13000	-	2172259..2172768 (+)	510	WP_002233029.1	protein disulfide oxidoreductase	-
DV179_RS13010	nadR	2173109..2173549 (+)	441	WP_002221507.1	MarR family adhesin repressor NadR	-
DV179_RS13015	hpaC	2173664..2174164 (+)	501	WP_024465094.1	4-hydroxyphenylacetate 3-monooxygenase, reductase component	-
DV179_RS13020	murU	2174182..2174877 (+)	696	WP_002237354.1	N-acetylmuramate alpha-1-phosphate uridylyltransferase MurU	-

Sequence

Protein

• Length: 42 a.a.
• Molecular weight: 4672.50 Da
• Isoelectric Point: 12.5257

>NTDB_id=305908 DV179_RS14675 WP_306821904.1 2169885..2170013(-) (pilC) [Neisseria meningitidis strain M26263]
MNKTLKRQVFRHTALYAAILMFSHTGGGGGGRWRKPVNTLLS

Nucleotide

• Length: 129 bp

>NTDB_id=305908 DV179_RS14675 WP_306821904.1 2169885..2170013(-) (pilC) [Neisseria meningitidis strain M26263]
ATGAATAAAACTTTAAAAAGGCAGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GGGGGGGGGGGGGCGATGGCGCAAACCCGTCAATACGCTATTATCATGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	96.667	71.429	0.69