Detailed information NTG0305764

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: DV144_RS14220
• Genome accession: NZ_CP031328
• Coordinates: 13289..13414 (+)
• Length: 41 a.a.
• NCBI ID: WP_275895500.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain M18755
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 8289..18414

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DV144_RS00045	hpaC	8736..9236 (-)	501	WP_101042283.1	4-hydroxyphenylacetate 3-monooxygenase, reductase component	-
DV144_RS00050	nadR	9351..9791 (-)	441	WP_115430663.1	MarR family adhesin repressor NadR	-
DV144_RS00060	-	10134..10643 (-)	510	WP_002249078.1	protein disulfide oxidoreductase	-
DV144_RS00070	apbC	11013..12092 (+)	1080	WP_101126242.1	iron-sulfur cluster carrier protein ApbC	-
DV144_RS14220	pilC	13289..13414 (+)	126	WP_275895500.1	hypothetical protein	Machinery gene
DV144_RS00080	pilC	13449..16559 (+)	3111	WP_115430664.1	PilC family type IV pilus tip adhesin	Machinery gene

Sequence

Protein

• Length: 41 a.a.
• Molecular weight: 4613.48 Da
• Isoelectric Point: 12.8111

>NTDB_id=305764 DV144_RS14220 WP_275895500.1 13289..13414(+) (pilC) [Neisseria meningitidis strain M18755]
MNKTLKRRVFRHTALYAAILMFSHTGGGGGRRRKPVNTLLS

Nucleotide

• Length: 126 bp

>NTDB_id=305764 DV144_RS14220 WP_275895500.1 13289..13414(+) (pilC) [Neisseria meningitidis strain M18755]
ATGAATAAAACTTTAAAAAGGCGGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GGGGGGGGGGCGCAGGCGCAAACCCGTCAATACGCTATTATCATGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	93.333	73.171	0.683