Detailed information NTG0304761

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: DV129_RS05250
• Genome accession: NZ_CP031247
• Coordinates: 981717..981866 (-)
• Length: 49 a.a.
• NCBI ID: WP_001809846.1
• Uniprot ID: Q00MV6
• Organism: Streptococcus pneumoniae strain M23734
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Genomic Context

Location: 976717..986866

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DV129_RS05200	-	976910..977704 (-)	795	WP_000363002.1	phosphotransferase family protein	-
DV129_RS05205	-	977865..978476 (-)	612	WP_000394048.1	type II CAAX endopeptidase family protein	-
DV129_RS05215	blpZ	978627..978860 (-)	234	WP_000276498.1	immunity protein BlpZ	-
DV129_RS05220	-	978902..979591 (-)	690	WP_000760532.1	CPBP family intramembrane glutamic endopeptidase	-
DV129_RS05225	-	979643..980026 (-)	384	WP_000877381.1	hypothetical protein	-
DV129_RS05235	-	980655..980974 (-)	320	Protein_994	immunity protein	-
DV129_RS05245	-	981494..981613 (-)	120	WP_000346296.1	PncF family bacteriocin immunity protein	-
DV129_RS05250	cipB	981717..981866 (-)	150	WP_001809846.1	bacteriocin-like peptide BlpO	Regulator
DV129_RS05260	blpN	982110..982313 (-)	204	WP_001099490.1	two-peptide bacteriocin subunit BlpN	-
DV129_RS05265	blpM	982329..982583 (-)	255	WP_001093255.1	two-peptide bacteriocin subunit BlpM	-
DV129_RS05270	comA/nlmT	982865..985018 (+)	2154	WP_000205160.1	peptide cleavage/export ABC transporter BlpA	Regulator
DV129_RS05275	-	985029..986390 (+)	1362	WP_001069063.1	bacteriocin secretion accessory protein	-
DV129_RS05280	blpC	986447..986602 (+)	156	WP_000358812.1	quorum-sensing system pheromone BlpC	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5149.92 Da
• Isoelectric Point: 4.0439

>NTDB_id=304761 DV129_RS05250 WP_001809846.1 981717..981866(-) (cipB) [Streptococcus pneumoniae strain M23734]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=304761 DV129_RS05250 WP_001809846.1 981717..981866(-) (cipB) [Streptococcus pneumoniae strain M23734]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

3D structure

• AlphaFold DB: Q00MV6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	53.061	100	0.531