Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   DS731_RS07415 Genome accession   NZ_CP031010
Coordinates   1692175..1692537 (+) Length   120 a.a.
NCBI ID   WP_161599120.1    Uniprot ID   -
Organism   Alteromonas sp. RKMC-009     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1666295..1710425 1692175..1692537 within 0


Gene organization within MGE regions


Location: 1666295..1710425
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DS731_RS07275 (DS731_07315) - 1666295..1666792 (+) 498 WP_119500698.1 HK97-gp10 family putative phage morphogenesis protein -
  DS731_RS07280 (DS731_07320) - 1666789..1667196 (+) 408 WP_119500699.1 hypothetical protein -
  DS731_RS07285 (DS731_07325) - 1667261..1667464 (+) 204 WP_119500700.1 hypothetical protein -
  DS731_RS07290 (DS731_07330) - 1667461..1668408 (+) 948 WP_119500701.1 hypothetical protein -
  DS731_RS07295 (DS731_07335) - 1668408..1668725 (+) 318 WP_119500702.1 hypothetical protein -
  DS731_RS07300 (DS731_07340) - 1668812..1669096 (+) 285 WP_119500703.1 DUF1799 domain-containing protein -
  DS731_RS07305 (DS731_07345) - 1669083..1672385 (+) 3303 WP_119500704.1 tape measure protein -
  DS731_RS07310 (DS731_07350) - 1672382..1672987 (+) 606 WP_119500705.1 hypothetical protein -
  DS731_RS07315 (DS731_07355) - 1672984..1673619 (+) 636 WP_119500706.1 hypothetical protein -
  DS731_RS07320 (DS731_07360) - 1673616..1674023 (+) 408 WP_119500707.1 hypothetical protein -
  DS731_RS07325 (DS731_07365) - 1674023..1679635 (+) 5613 WP_119500708.1 collagen-like protein -
  DS731_RS07330 (DS731_07370) - 1679644..1680030 (+) 387 WP_119500709.1 hypothetical protein -
  DS731_RS07335 (DS731_07375) - 1680138..1680506 (+) 369 WP_119500710.1 hypothetical protein -
  DS731_RS07340 (DS731_07380) - 1680519..1682480 (+) 1962 WP_119500711.1 right-handed parallel beta-helix repeat-containing protein -
  DS731_RS07345 (DS731_07385) - 1682477..1683325 (+) 849 WP_119500712.1 hypothetical protein -
  DS731_RS07350 (DS731_07390) - 1683392..1683763 (+) 372 WP_119500713.1 hypothetical protein -
  DS731_RS07355 (DS731_07395) - 1683760..1684203 (+) 444 WP_119500714.1 DUF5675 family protein -
  DS731_RS07360 (DS731_07400) - 1684196..1684735 (+) 540 WP_119500715.1 hypothetical protein -
  DS731_RS07365 (DS731_07405) - 1684732..1685493 (-) 762 WP_119500716.1 hypothetical protein -
  DS731_RS07370 (DS731_07410) - 1685730..1685921 (+) 192 WP_119500717.1 hypothetical protein -
  DS731_RS07375 (DS731_07415) - 1685921..1686253 (+) 333 WP_119500718.1 hypothetical protein -
  DS731_RS07380 (DS731_07420) - 1686264..1686746 (+) 483 WP_119500719.1 phage regulatory CII family protein -
  DS731_RS07385 (DS731_07425) - 1686730..1686987 (+) 258 WP_119500720.1 hypothetical protein -
  DS731_RS21890 - 1686980..1687156 (+) 177 WP_161599118.1 hypothetical protein -
  DS731_RS07390 (DS731_07430) - 1687149..1687781 (+) 633 WP_119500721.1 tyrosine-type recombinase/integrase -
  DS731_RS22340 - 1687778..1687909 (+) 132 WP_269748662.1 hypothetical protein -
  DS731_RS07395 (DS731_07435) - 1687902..1688177 (+) 276 WP_119500722.1 hypothetical protein -
  DS731_RS07400 (DS731_07440) - 1688202..1690970 (+) 2769 WP_119500723.1 toprim domain-containing protein -
  DS731_RS07405 (DS731_07445) - 1691166..1691768 (+) 603 WP_119500724.1 hypothetical protein -
  DS731_RS07410 (DS731_07450) - 1691770..1692015 (+) 246 WP_119500725.1 hypothetical protein -
  DS731_RS21895 - 1692012..1692185 (+) 174 WP_161599119.1 hypothetical protein -
  DS731_RS07415 (DS731_07455) ssb 1692175..1692537 (+) 363 WP_161599120.1 single-stranded DNA-binding protein Machinery gene
  DS731_RS07420 (DS731_07460) - 1692589..1692771 (+) 183 WP_119500727.1 hypothetical protein -
  DS731_RS07425 (DS731_07465) - 1692768..1693088 (+) 321 WP_119500728.1 hypothetical protein -
  DS731_RS07430 (DS731_07470) - 1693081..1693275 (+) 195 WP_119500729.1 sigma factor-like helix-turn-helix DNA-binding protein -
  DS731_RS21900 - 1693287..1693442 (+) 156 WP_161599121.1 hypothetical protein -
  DS731_RS07435 (DS731_07475) - 1693462..1694001 (+) 540 WP_119500730.1 phage antirepressor N-terminal domain-containing protein -
  DS731_RS07440 (DS731_07480) - 1694012..1694518 (+) 507 WP_119500731.1 hypothetical protein -
  DS731_RS07450 (DS731_07490) - 1694708..1694923 (+) 216 WP_119500733.1 hypothetical protein -
  DS731_RS07455 (DS731_07495) - 1694920..1695228 (+) 309 WP_150154259.1 hypothetical protein -
  DS731_RS07460 (DS731_07500) - 1695364..1695639 (+) 276 WP_119500735.1 hypothetical protein -
  DS731_RS07465 (DS731_07505) - 1695657..1696031 (+) 375 WP_119500736.1 hypothetical protein -
  DS731_RS21905 - 1696105..1696254 (-) 150 WP_161599122.1 hypothetical protein -
  DS731_RS07470 (DS731_07510) - 1696380..1696766 (-) 387 WP_232373507.1 helix-turn-helix domain-containing protein -
  DS731_RS07475 (DS731_07515) - 1697172..1698167 (+) 996 WP_119500737.1 tyrosine-type recombinase/integrase -
  DS731_RS07480 (DS731_07520) - 1698606..1699010 (+) 405 WP_119500738.1 hypothetical protein -
  DS731_RS07485 (DS731_07525) - 1699300..1699593 (+) 294 WP_119500739.1 hypothetical protein -
  DS731_RS07490 (DS731_07530) - 1699841..1700263 (+) 423 WP_150154261.1 DUF6210 family protein -
  DS731_RS07495 (DS731_07535) - 1700256..1700570 (+) 315 WP_119500741.1 hypothetical protein -
  DS731_RS07500 (DS731_07540) - 1700572..1700760 (-) 189 WP_119500742.1 hypothetical protein -
  DS731_RS07525 (DS731_07565) - 1703570..1704880 (+) 1311 WP_232373545.1 MATE family efflux transporter -
  DS731_RS07530 (DS731_07570) uvrB 1704877..1706892 (+) 2016 WP_119500743.1 excinuclease ABC subunit UvrB -
  DS731_RS07535 (DS731_07575) - 1707067..1707993 (+) 927 WP_119500744.1 LysR family transcriptional regulator -
  DS731_RS07540 (DS731_07580) queC 1708072..1708728 (-) 657 WP_119500745.1 7-cyano-7-deazaguanine synthase QueC -
  DS731_RS07545 (DS731_07585) queE 1708845..1709495 (+) 651 WP_232373546.1 7-carboxy-7-deazaguanine synthase QueE -
  DS731_RS07550 (DS731_07590) - 1709538..1710425 (+) 888 WP_119500747.1 amino acid ABC transporter substrate-binding protein -

Sequence

Protein


Download         Length: 120 a.a.        Molecular weight: 13361.98 Da        Isoelectric Point: 8.8679

>NTDB_id=302797 DS731_RS07415 WP_161599120.1 1692175..1692537(+) (ssb) [Alteromonas sp. RKMC-009]
MATKGVNSVTLVGNLGSDPQLRYTQRNVAVCNISLATSEVYKDQNGKKVEETEWHKVVVWGKKAEVVAQFRASGDQLYVR
GKNKTRKWTDENGQDHYVTEVIVDQNGDIQLLGGKNPQSV

Nucleotide


Download         Length: 363 bp        

>NTDB_id=302797 DS731_RS07415 WP_161599120.1 1692175..1692537(+) (ssb) [Alteromonas sp. RKMC-009]
GTGGCAACTAAAGGTGTTAATTCCGTGACCCTCGTGGGCAACTTAGGTTCAGACCCGCAACTGCGTTACACACAACGCAA
CGTGGCCGTGTGCAATATCTCACTGGCCACTTCAGAAGTGTACAAAGACCAGAATGGCAAGAAGGTTGAGGAAACCGAAT
GGCACAAAGTGGTGGTGTGGGGAAAAAAAGCTGAAGTCGTAGCCCAGTTCCGTGCCAGCGGCGATCAACTCTATGTGCGC
GGTAAGAACAAAACCCGCAAATGGACCGACGAAAACGGACAAGATCACTACGTGACCGAAGTTATCGTTGACCAAAACGG
AGACATTCAACTGCTCGGTGGCAAAAACCCACAGAGCGTGTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-105)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

50.427

97.5

0.492
  ssb Glaesserella parasuis strain SC1401

49.505

84.167

0.417

Multiple sequence alignment