Detailed information    

insolico Bioinformatically predicted

Overview

Name   comFC   Type   Machinery gene
Locus tag   DT351_RS08230 Genome accession   NZ_CP031003
Coordinates   1574870..1575400 (-) Length   176 a.a.
NCBI ID   WP_162875352.1    Uniprot ID   -
Organism   Latilactobacillus curvatus strain TMW 1.1928     
Function   ssDNA transport into the cell (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1545479..1593680 1574870..1575400 within 0


Gene organization within MGE regions


Location: 1545479..1593680
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DT351_RS08085 (DT351_08085) - 1546081..1546713 (-) 633 WP_004265951.1 YfbR-like 5'-deoxynucleotidase -
  DT351_RS08090 (DT351_08090) - 1546826..1548550 (-) 1725 WP_116843691.1 phospho-sugar mutase -
  DT351_RS08095 (DT351_08095) trxB 1548880..1549800 (-) 921 WP_004265965.1 thioredoxin-disulfide reductase -
  DT351_RS08100 (DT351_08100) - 1549888..1550244 (-) 357 WP_004265931.1 hypothetical protein -
  DT351_RS08105 (DT351_08105) - 1550410..1551438 (-) 1029 WP_004265961.1 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase -
  DT351_RS08110 (DT351_08110) lgt 1551466..1552299 (-) 834 WP_004265937.1 prolipoprotein diacylglyceryl transferase -
  DT351_RS08115 (DT351_08115) hprK 1552666..1553607 (-) 942 WP_004265923.1 HPr(Ser) kinase/phosphatase -
  DT351_RS08120 (DT351_08120) - 1553752..1554105 (-) 354 WP_004265953.1 phage holin family protein -
  DT351_RS08125 (DT351_08125) - 1554105..1554404 (-) 300 WP_004265882.1 hypothetical protein -
  DT351_RS08130 (DT351_08130) - 1554404..1554637 (-) 234 WP_035186190.1 PspC domain-containing protein -
  DT351_RS08135 (DT351_08135) liaX 1554665..1556119 (-) 1455 WP_004265927.1 daptomycin-sensing surface protein LiaX -
  DT351_RS08140 (DT351_08140) - 1556345..1557019 (+) 675 WP_076648203.1 helix-turn-helix domain-containing protein -
  DT351_RS08145 (DT351_08145) - 1557016..1557897 (+) 882 WP_089542300.1 IS3 family transposase -
  DT351_RS08150 (DT351_08150) - 1557970..1558440 (-) 471 WP_004270223.1 nucleoside 2-deoxyribosyltransferase -
  DT351_RS08155 (DT351_08155) phoU 1558515..1559192 (-) 678 WP_004270249.1 phosphate signaling complex protein PhoU -
  DT351_RS08160 (DT351_08160) pstB 1559211..1559969 (-) 759 WP_004270242.1 phosphate ABC transporter ATP-binding protein PstB -
  DT351_RS08165 (DT351_08165) pstB 1559990..1560799 (-) 810 WP_004270235.1 phosphate ABC transporter ATP-binding protein PstB -
  DT351_RS08170 (DT351_08170) pstA 1560809..1561693 (-) 885 WP_004270246.1 phosphate ABC transporter permease PstA -
  DT351_RS08175 (DT351_08175) pstC 1561693..1562616 (-) 924 WP_004270247.1 phosphate ABC transporter permease subunit PstC -
  DT351_RS08180 (DT351_08180) - 1562627..1563487 (-) 861 WP_065825893.1 phosphate ABC transporter substrate-binding protein PstS family protein -
  DT351_RS08185 (DT351_08185) - 1563582..1565243 (-) 1662 WP_065825894.1 ATP-binding protein -
  DT351_RS08190 (DT351_08190) - 1565230..1565943 (-) 714 WP_004270257.1 response regulator transcription factor -
  DT351_RS08195 (DT351_08195) - 1565964..1567094 (-) 1131 WP_223315838.1 PDZ domain-containing protein -
  DT351_RS08200 (DT351_08200) - 1567426..1568478 (+) 1053 WP_089541951.1 IS30 family transposase -
  DT351_RS08205 (DT351_08205) ftsX 1568725..1569612 (-) 888 WP_004270230.1 permease-like cell division protein FtsX -
  DT351_RS08210 (DT351_08210) ftsE 1569602..1570288 (-) 687 WP_076787035.1 cell division ATP-binding protein FtsE -
  DT351_RS08220 (DT351_08220) secA 1571607..1573970 (-) 2364 WP_076787039.1 preprotein translocase subunit SecA -
  DT351_RS08225 (DT351_08225) raiA 1574199..1574744 (-) 546 WP_004270226.1 ribosome-associated translation inhibitor RaiA -
  DT351_RS08230 (DT351_08230) comFC 1574870..1575400 (-) 531 WP_162875352.1 ComF family protein Machinery gene
  DT351_RS08235 (DT351_08235) comFA 1575544..1576878 (-) 1335 WP_100069772.1 DEAD/DEAH box helicase Machinery gene
  DT351_RS08240 (DT351_08240) - 1576935..1577597 (+) 663 WP_116843692.1 YigZ family protein -
  DT351_RS08245 (DT351_08245) - 1577622..1578710 (-) 1089 WP_004270225.1 MraY family glycosyltransferase -
  DT351_RS08250 (DT351_08250) hemH 1578820..1579771 (-) 952 Protein_1613 ferrochelatase -
  DT351_RS08255 (DT351_08255) rny 1579771..1581333 (-) 1563 WP_116843693.1 ribonuclease Y -
  DT351_RS08260 (DT351_08260) recA 1581577..1582635 (-) 1059 WP_004270239.1 recombinase RecA Machinery gene
  DT351_RS08265 (DT351_08265) pgsA 1582827..1583411 (-) 585 WP_004270254.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  DT351_RS08270 (DT351_08270) - 1583434..1584357 (-) 924 WP_004270224.1 helix-turn-helix domain-containing protein -
  DT351_RS08275 (DT351_08275) - 1584440..1585168 (-) 729 WP_004270241.1 SDR family oxidoreductase -
  DT351_RS08280 (DT351_08280) - 1585161..1586471 (-) 1311 WP_076787044.1 pitrilysin family protein -
  DT351_RS08285 (DT351_08285) - 1586461..1587732 (-) 1272 WP_076787046.1 pitrilysin family protein -
  DT351_RS08290 (DT351_08290) - 1587899..1588792 (-) 894 WP_116843694.1 IS3 family transposase -
  DT351_RS08295 (DT351_08295) - 1588789..1589463 (-) 675 WP_089542092.1 helix-turn-helix domain-containing protein -
  DT351_RS08300 (DT351_08300) - 1589679..1592027 (-) 2349 WP_076786358.1 DNA translocase FtsK -
  DT351_RS08305 (DT351_08305) - 1592169..1592570 (-) 402 WP_004270251.1 DUF1149 family protein -
  DT351_RS08310 (DT351_08310) trmL 1592583..1593092 (-) 510 WP_004270256.1 tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL -

Sequence

Protein


Download         Length: 176 a.a.        Molecular weight: 20677.75 Da        Isoelectric Point: 9.7337

>NTDB_id=302784 DT351_RS08230 WP_162875352.1 1574870..1575400(-) (comFC) [Latilactobacillus curvatus strain TMW 1.1928]
MTTQGVCPDCQRWQQLYPGEQFTNRALLTYNEPMQQYFQRYKGQGDYRLRHVFQRLIRENFPVQRQTAYIPVPTDPTHLQ
SRGFNPVVGLYEDCFPLTPLLQKLPTEKGQAQKNRAERLATPQFFKCAQNVPLSSKVQQLILLDDIYTTGRTLWHAQQCL
RKRYQTLPIHAITLVH

Nucleotide


Download         Length: 531 bp        

>NTDB_id=302784 DT351_RS08230 WP_162875352.1 1574870..1575400(-) (comFC) [Latilactobacillus curvatus strain TMW 1.1928]
ATGACAACCCAGGGGGTGTGTCCGGATTGCCAGAGATGGCAGCAACTGTATCCAGGCGAACAATTTACTAATCGAGCGTT
GTTAACATACAACGAACCAATGCAACAGTATTTTCAACGCTATAAGGGGCAGGGGGATTATCGATTACGTCACGTATTTC
AACGGCTGATTCGAGAAAATTTTCCTGTGCAACGGCAAACGGCGTATATCCCAGTCCCGACTGATCCAACACATTTGCAA
AGCCGCGGATTCAATCCGGTGGTTGGCTTATACGAGGACTGTTTTCCACTGACCCCATTGTTGCAGAAGCTACCAACTGA
AAAAGGACAAGCACAAAAAAATCGTGCAGAGCGCTTAGCAACGCCGCAATTTTTTAAATGCGCGCAGAACGTGCCGTTGA
GTTCCAAGGTGCAGCAGTTAATTTTGTTGGATGATATTTATACCACTGGGCGCACGTTATGGCATGCTCAGCAGTGTCTC
CGCAAGCGATACCAAACGCTGCCAATTCACGCAATTACTTTAGTCCACTAG

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comFC Latilactobacillus sakei subsp. sakei 23K

65.734

81.25

0.534

Multiple sequence alignment