Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT63_RS00680 Genome accession   NZ_CP035436
Coordinates   104293..104577 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm89.14     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99293..109577
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT63_RS00655 (ETT63_00655) - 101239..101604 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT63_RS00660 (ETT63_00660) comGA 101697..102635 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT63_RS00665 (ETT63_00665) comGB 102571..103605 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT63_RS00670 (ETT63_00670) comGC 103607..103933 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT63_RS00675 (ETT63_00675) comGD 103908..104336 (+) 429 WP_136267768.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT63_RS00680 (ETT63_00680) comGE 104293..104577 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT63_RS00685 (ETT63_00685) comGF 104570..105004 (+) 435 WP_111711329.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT63_RS00690 (ETT63_00690) comGG 104988..105314 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT63_RS00695 (ETT63_00695) comGH 105412..106365 (+) 954 WP_136267746.1 class I SAM-dependent methyltransferase Machinery gene
  ETT63_RS00700 (ETT63_00700) - 106424..107620 (+) 1197 WP_111711330.1 acetate kinase -
  ETT63_RS00705 (ETT63_00705) - 107807..108115 (+) 309 WP_011284425.1 hypothetical protein -
  ETT63_RS00710 (ETT63_00710) proC 108198..108968 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=301714 ETT63_RS00680 WP_011284422.1 104293..104577(+) (comGE) [Streptococcus pyogenes strain emm89.14]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=301714 ETT63_RS00680 WP_011284422.1 104293..104577(+) (comGE) [Streptococcus pyogenes strain emm89.14]
GTGGGAATTATCAAAAAACAAGTCAAGGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGTAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment