Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ETT64_RS00785 Genome accession   NZ_CP035435
Coordinates   118150..118434 (+) Length   94 a.a.
NCBI ID   WP_315940846.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm64.3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 113150..123434
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT64_RS00760 (ETT64_00760) - 115096..115461 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT64_RS00765 (ETT64_00765) comGA 115554..116492 (+) 939 WP_063812149.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT64_RS00770 (ETT64_00770) comGB 116428..117462 (+) 1035 WP_227868957.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT64_RS00775 (ETT64_00775) comGC 117464..117790 (+) 327 WP_011528161.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT64_RS00780 (ETT64_00780) comGD 117765..118193 (+) 429 WP_136293154.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT64_RS00785 (ETT64_00785) comGE 118150..118434 (+) 285 WP_315940846.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT64_RS00790 (ETT64_00790) comGF 118427..118861 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT64_RS00795 (ETT64_00795) comGG 118845..119171 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT64_RS00800 (ETT64_00800) comGH 119269..120222 (+) 954 WP_136293153.1 class I SAM-dependent methyltransferase Machinery gene
  ETT64_RS00805 (ETT64_00805) - 120281..121477 (+) 1197 WP_011284424.1 acetate kinase -
  ETT64_RS00810 (ETT64_00810) - 121664..121972 (+) 309 Protein_111 hypothetical protein -
  ETT64_RS00815 (ETT64_00815) proC 122055..122825 (-) 771 WP_136293152.1 pyrroline-5-carboxylate reductase -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10700.64 Da        Isoelectric Point: 8.9140

>NTDB_id=301620 ETT64_RS00785 WP_315940846.1 118150..118434(+) (comGE) [Streptococcus pyogenes strain emm64.3]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRRQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=301620 ETT64_RS00785 WP_315940846.1 118150..118434(+) (comGE) [Streptococcus pyogenes strain emm64.3]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCACTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAGGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA

Domains

Predicted by InterProScan.

Type II secretory pathway pseudopilin (ComGE)

(12-93)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383

Multiple sequence alignment