Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   DQW72_RS07740 Genome accession   NZ_CP030246
Coordinates   1604388..1605260 (-) Length   290 a.a.
NCBI ID   WP_002484839.1    Uniprot ID   A0A4Y7VXK4
Organism   Staphylococcus epidermidis strain CSF41498     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1565928..1636802 1604388..1605260 within 0


Gene organization within MGE regions


Location: 1565928..1636802
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQW72_RS07595 (DQW72_07570) yfmF 1566968..1568239 (-) 1272 WP_002439538.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  DQW72_RS07600 (DQW72_07575) - 1568270..1568983 (-) 714 WP_002439536.1 GntR family transcriptional regulator -
  DQW72_RS07605 (DQW72_07580) - 1568986..1571379 (-) 2394 WP_049392165.1 DNA translocase FtsK -
  DQW72_RS07610 (DQW72_07585) rnjB 1571645..1573318 (-) 1674 WP_002457357.1 ribonuclease J2 -
  DQW72_RS07615 (DQW72_07590) pnp 1573686..1575791 (-) 2106 WP_001832554.1 polyribonucleotide nucleotidyltransferase -
  DQW72_RS07620 (DQW72_07595) rpsO 1575923..1576192 (-) 270 WP_002439528.1 30S ribosomal protein S15 -
  DQW72_RS07625 (DQW72_07600) - 1576312..1577283 (-) 972 WP_001832563.1 bifunctional riboflavin kinase/FAD synthetase -
  DQW72_RS07630 (DQW72_07605) truB 1577299..1578216 (-) 918 WP_002456563.1 tRNA pseudouridine(55) synthase TruB -
  DQW72_RS07635 (DQW72_07610) rbfA 1578354..1578704 (-) 351 WP_001829509.1 30S ribosome-binding factor RbfA -
  DQW72_RS07640 (DQW72_07615) infB 1579007..1581169 (-) 2163 WP_002468903.1 translation initiation factor IF-2 -
  DQW72_RS07645 (DQW72_07620) - 1581174..1581491 (-) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  DQW72_RS07650 (DQW72_07625) rnpM 1581491..1581775 (-) 285 WP_001829465.1 RNase P modulator RnpM -
  DQW72_RS07655 (DQW72_07630) nusA 1581793..1583016 (-) 1224 WP_002456565.1 transcription termination factor NusA -
  DQW72_RS07660 (DQW72_07635) rimP 1583037..1583504 (-) 468 WP_002439519.1 ribosome maturation factor RimP -
  DQW72_RS07665 (DQW72_07640) - 1583683..1587993 (-) 4311 WP_002456566.1 PolC-type DNA polymerase III -
  DQW72_RS07670 (DQW72_07645) - 1588243..1589946 (-) 1704 WP_001829513.1 proline--tRNA ligase -
  DQW72_RS07675 (DQW72_07650) rseP 1589965..1591251 (-) 1287 WP_001829501.1 RIP metalloprotease RseP -
  DQW72_RS07680 (DQW72_07655) - 1591485..1592267 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  DQW72_RS07685 (DQW72_07660) - 1592271..1593041 (-) 771 WP_001832561.1 isoprenyl transferase -
  DQW72_RS07690 (DQW72_07665) frr 1593262..1593816 (-) 555 WP_001829472.1 ribosome recycling factor -
  DQW72_RS07695 (DQW72_07670) pyrH 1593833..1594555 (-) 723 WP_002439511.1 UMP kinase -
  DQW72_RS07700 (DQW72_07675) tsf 1594696..1595574 (-) 879 WP_002439509.1 translation elongation factor Ts -
  DQW72_RS07705 (DQW72_07680) rpsB 1595726..1596514 (-) 789 WP_001832557.1 30S ribosomal protein S2 -
  DQW72_RS07710 (DQW72_07685) codY 1596877..1597647 (-) 771 WP_002439506.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  DQW72_RS07715 (DQW72_07690) hslU 1597671..1599074 (-) 1404 WP_001829474.1 ATP-dependent protease ATPase subunit HslU -
  DQW72_RS07720 (DQW72_07695) hslV 1599143..1599685 (-) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  DQW72_RS07725 (DQW72_07700) xerC 1599689..1600549 (-) 861 WP_002439503.1 tyrosine recombinase XerC -
  DQW72_RS07730 (DQW72_07705) trmFO 1600804..1602111 (-) 1308 WP_114064936.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  DQW72_RS07735 (DQW72_07710) topA 1602136..1604205 (-) 2070 WP_001829508.1 type I DNA topoisomerase -
  DQW72_RS07740 (DQW72_07715) dprA 1604388..1605260 (-) 873 WP_002484839.1 DNA-processing protein DprA Machinery gene
  DQW72_RS07750 (DQW72_07725) sucD 1606065..1606973 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  DQW72_RS07755 (DQW72_07730) sucC 1606995..1608161 (-) 1167 WP_002439496.1 ADP-forming succinate--CoA ligase subunit beta -
  DQW72_RS07760 (DQW72_07735) - 1608269..1609039 (-) 771 WP_001829514.1 ribonuclease HII -
  DQW72_RS07765 (DQW72_07740) ylqF 1609044..1609907 (-) 864 WP_002468554.1 ribosome biogenesis GTPase YlqF -
  DQW72_RS12945 (DQW72_07745) - 1609928..1610077 (-) 150 WP_162152279.1 hypothetical protein -
  DQW72_RS07775 (DQW72_07750) - 1610236..1612836 (+) 2601 WP_010959172.1 YfhO family protein -
  DQW72_RS07780 (DQW72_07755) - 1612829..1615432 (+) 2604 WP_020368058.1 YfhO family protein -
  DQW72_RS07785 (DQW72_07760) rplS 1615962..1616312 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  DQW72_RS07790 (DQW72_07765) trmD 1616418..1617155 (-) 738 WP_001829466.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  DQW72_RS07795 (DQW72_07770) rimM 1617155..1617658 (-) 504 WP_001832559.1 ribosome maturation factor RimM -
  DQW72_RS07800 (DQW72_07775) rpsP 1617785..1618060 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  DQW72_RS07805 (DQW72_07780) ffh 1618368..1619735 (-) 1368 WP_001830113.1 signal recognition particle protein -
  DQW72_RS07810 (DQW72_07785) - 1619766..1620098 (-) 333 WP_002457379.1 putative DNA-binding protein -
  DQW72_RS07815 (DQW72_07790) ftsY 1620100..1621326 (-) 1227 WP_001830080.1 signal recognition particle-docking protein FtsY -
  DQW72_RS07820 (DQW72_07795) smc 1621323..1624892 (-) 3570 WP_002502436.1 chromosome segregation protein SMC -
  DQW72_RS07825 (DQW72_07800) rnc 1625019..1625756 (-) 738 WP_002470220.1 ribonuclease III -
  DQW72_RS07830 (DQW72_07805) - 1625871..1626104 (-) 234 WP_001830184.1 acyl carrier protein -
  DQW72_RS07835 (DQW72_07810) fabG 1626331..1627065 (-) 735 WP_001830161.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  DQW72_RS07840 (DQW72_07815) fabD 1627058..1627984 (-) 927 WP_001830062.1 ACP S-malonyltransferase -
  DQW72_RS07845 (DQW72_07820) plsX 1627986..1628963 (-) 978 WP_001830112.1 phosphate acyltransferase PlsX -
  DQW72_RS07850 (DQW72_07825) fapR 1628965..1629525 (-) 561 WP_001830099.1 transcription factor FapR -
  DQW72_RS07855 (DQW72_07830) recG 1629684..1631732 (-) 2049 WP_020368084.1 ATP-dependent DNA helicase RecG -
  DQW72_RS07860 (DQW72_07835) fakA 1631936..1633594 (-) 1659 WP_002489351.1 fatty acid kinase catalytic subunit FakA -
  DQW72_RS07865 (DQW72_07840) - 1633609..1633983 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -
  DQW72_RS07870 (DQW72_07845) rpmB 1634341..1634529 (+) 189 WP_001830107.1 50S ribosomal protein L28 -
  DQW72_RS07875 (DQW72_07850) - 1634612..1635247 (-) 636 WP_002489340.1 thiamine diphosphokinase -
  DQW72_RS07880 (DQW72_07855) rpe 1635252..1635896 (-) 645 WP_001830173.1 ribulose-phosphate 3-epimerase -
  DQW72_RS07885 (DQW72_07860) rsgA 1635897..1636772 (-) 876 WP_002456227.1 ribosome small subunit-dependent GTPase A -

Sequence


Protein


Download         Length: 290 a.a.        Molecular weight: 33717.61 Da        Isoelectric Point: 9.3616

>NTDB_id=300389 DQW72_RS07740 WP_002484839.1 1604388..1605260(-) (dprA) [Staphylococcus epidermidis strain CSF41498]
MIQQTMLKLYWANFTTAQLHHLTSTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKLMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLARGADSVAHQ
TALKYLLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPISKHKFPERNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=300389 DQW72_RS07740 WP_002484839.1 1604388..1605260(-) (dprA) [Staphylococcus epidermidis strain CSF41498]
TTGATACAACAGACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACAAGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGGCTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGCTGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACCTATTACCAACTATTGGCGTACTTGGATTTGGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAGTAAGCATAAATTTC
CTGAAAGAAACAGGCTTATAAGTGGTCTGTCCAGAGGGGTACTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A4Y7VXK4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

56.944

99.31

0.566

  dprA Staphylococcus aureus N315

56.944

99.31

0.566


Multiple sequence alignment