Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ETA15_RS12740 Genome accession   NZ_CP035403
Coordinates   2383980..2384153 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM103581     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2378980..2389153
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA15_RS12725 (ETA15_12725) gcvT 2379780..2380868 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  ETA15_RS12730 (ETA15_12730) hepAA 2381309..2382982 (+) 1674 WP_017696203.1 SNF2-related protein -
  ETA15_RS12735 (ETA15_12735) yqhG 2383003..2383797 (+) 795 WP_017696202.1 YqhG family protein -
  ETA15_RS12740 (ETA15_12740) sinI 2383980..2384153 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETA15_RS12745 (ETA15_12745) sinR 2384187..2384522 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETA15_RS12750 (ETA15_12750) tasA 2384615..2385400 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  ETA15_RS12755 (ETA15_12755) sipW 2385465..2386037 (-) 573 WP_080031082.1 signal peptidase I SipW -
  ETA15_RS12760 (ETA15_12760) tapA 2386021..2386776 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  ETA15_RS12765 (ETA15_12765) yqzG 2387047..2387373 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  ETA15_RS12770 (ETA15_12770) spoIITA 2387415..2387594 (-) 180 WP_014480252.1 YqzE family protein -
  ETA15_RS12775 (ETA15_12775) comGG 2387665..2388039 (-) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  ETA15_RS12780 (ETA15_12780) comGF 2388040..2388423 (-) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  ETA15_RS12785 (ETA15_12785) comGE 2388449..2388796 (-) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=299803 ETA15_RS12740 WP_003230187.1 2383980..2384153(+) (sinI) [Bacillus subtilis strain SRCM103581]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=299803 ETA15_RS12740 WP_003230187.1 2383980..2384153(+) (sinI) [Bacillus subtilis strain SRCM103581]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1