Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ETA15_RS12740 | Genome accession | NZ_CP035403 |
| Coordinates | 2383980..2384153 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain SRCM103581 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2378980..2389153
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETA15_RS12725 (ETA15_12725) | gcvT | 2379780..2380868 (-) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ETA15_RS12730 (ETA15_12730) | hepAA | 2381309..2382982 (+) | 1674 | WP_017696203.1 | SNF2-related protein | - |
| ETA15_RS12735 (ETA15_12735) | yqhG | 2383003..2383797 (+) | 795 | WP_017696202.1 | YqhG family protein | - |
| ETA15_RS12740 (ETA15_12740) | sinI | 2383980..2384153 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| ETA15_RS12745 (ETA15_12745) | sinR | 2384187..2384522 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| ETA15_RS12750 (ETA15_12750) | tasA | 2384615..2385400 (-) | 786 | WP_017696201.1 | biofilm matrix protein TasA | - |
| ETA15_RS12755 (ETA15_12755) | sipW | 2385465..2386037 (-) | 573 | WP_080031082.1 | signal peptidase I SipW | - |
| ETA15_RS12760 (ETA15_12760) | tapA | 2386021..2386776 (-) | 756 | WP_017696199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ETA15_RS12765 (ETA15_12765) | yqzG | 2387047..2387373 (+) | 327 | WP_026113671.1 | YqzG/YhdC family protein | - |
| ETA15_RS12770 (ETA15_12770) | spoIITA | 2387415..2387594 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| ETA15_RS12775 (ETA15_12775) | comGG | 2387665..2388039 (-) | 375 | WP_017696197.1 | ComG operon protein ComGG | Machinery gene |
| ETA15_RS12780 (ETA15_12780) | comGF | 2388040..2388423 (-) | 384 | WP_017696196.1 | ComG operon protein ComGF | Machinery gene |
| ETA15_RS12785 (ETA15_12785) | comGE | 2388449..2388796 (-) | 348 | WP_017696195.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=299803 ETA15_RS12740 WP_003230187.1 2383980..2384153(+) (sinI) [Bacillus subtilis strain SRCM103581]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=299803 ETA15_RS12740 WP_003230187.1 2383980..2384153(+) (sinI) [Bacillus subtilis strain SRCM103581]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |