Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ETA15_RS12775 Genome accession   NZ_CP035403
Coordinates   2387665..2388039 (-) Length   124 a.a.
NCBI ID   WP_017696197.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103581     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2382665..2393039
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA15_RS12735 (ETA15_12735) yqhG 2383003..2383797 (+) 795 WP_017696202.1 YqhG family protein -
  ETA15_RS12740 (ETA15_12740) sinI 2383980..2384153 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETA15_RS12745 (ETA15_12745) sinR 2384187..2384522 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETA15_RS12750 (ETA15_12750) tasA 2384615..2385400 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  ETA15_RS12755 (ETA15_12755) sipW 2385465..2386037 (-) 573 WP_080031082.1 signal peptidase I SipW -
  ETA15_RS12760 (ETA15_12760) tapA 2386021..2386776 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  ETA15_RS12765 (ETA15_12765) yqzG 2387047..2387373 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  ETA15_RS12770 (ETA15_12770) spoIITA 2387415..2387594 (-) 180 WP_014480252.1 YqzE family protein -
  ETA15_RS12775 (ETA15_12775) comGG 2387665..2388039 (-) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  ETA15_RS12780 (ETA15_12780) comGF 2388040..2388423 (-) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  ETA15_RS12785 (ETA15_12785) comGE 2388449..2388796 (-) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETA15_RS12790 (ETA15_12790) comGD 2388780..2389211 (-) 432 WP_017696194.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETA15_RS12795 (ETA15_12795) comGC 2389201..2389497 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ETA15_RS12800 (ETA15_12800) comGB 2389511..2390548 (-) 1038 WP_017696193.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETA15_RS12805 (ETA15_12805) comGA 2390535..2391605 (-) 1071 WP_017696192.1 competence protein ComGA Machinery gene
  ETA15_RS12815 (ETA15_12815) corA 2392015..2392968 (-) 954 WP_017696189.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14526.75 Da        Isoelectric Point: 9.7778

>NTDB_id=299805 ETA15_RS12775 WP_017696197.1 2387665..2388039(-) (comGG) [Bacillus subtilis strain SRCM103581]
MYRTRGFIYPAVLFVSALVLLIVNFASAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=299805 ETA15_RS12775 WP_017696197.1 2387665..2388039(-) (comGG) [Bacillus subtilis strain SRCM103581]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTACTGTTAATCGTGAACTTTGCTTC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952