Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BVDSYZ_RS13425 Genome accession   NZ_CP030150
Coordinates   2701524..2701901 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain DSYZ     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2696524..2706901
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVDSYZ_RS13385 (BVDSYZ_13385) - 2697022..2697816 (+) 795 WP_007408330.1 YqhG family protein -
  BVDSYZ_RS13390 (BVDSYZ_13390) sinI 2697993..2698166 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  BVDSYZ_RS13395 (BVDSYZ_13395) sinR 2698200..2698535 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BVDSYZ_RS13400 (BVDSYZ_13400) - 2698583..2699368 (-) 786 WP_007408329.1 TasA family protein -
  BVDSYZ_RS13405 (BVDSYZ_13405) - 2699433..2700017 (-) 585 WP_015240205.1 signal peptidase I -
  BVDSYZ_RS13410 (BVDSYZ_13410) tapA 2699989..2700660 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  BVDSYZ_RS13415 (BVDSYZ_13415) - 2700919..2701248 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  BVDSYZ_RS13420 (BVDSYZ_13420) - 2701288..2701467 (-) 180 WP_003153093.1 YqzE family protein -
  BVDSYZ_RS13425 (BVDSYZ_13425) comGG 2701524..2701901 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BVDSYZ_RS13430 (BVDSYZ_13430) comGF 2701902..2702402 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  BVDSYZ_RS13435 (BVDSYZ_13435) comGE 2702311..2702625 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BVDSYZ_RS13440 (BVDSYZ_13440) comGD 2702609..2703046 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  BVDSYZ_RS13445 (BVDSYZ_13445) comGC 2703036..2703344 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  BVDSYZ_RS13450 (BVDSYZ_13450) comGB 2703349..2704386 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  BVDSYZ_RS13455 (BVDSYZ_13455) comGA 2704373..2705443 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BVDSYZ_RS13460 (BVDSYZ_13460) - 2705636..2706586 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=299717 BVDSYZ_RS13425 WP_015417814.1 2701524..2701901(-) (comGG) [Bacillus velezensis strain DSYZ]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=299717 BVDSYZ_RS13425 WP_015417814.1 2701524..2701901(-) (comGG) [Bacillus velezensis strain DSYZ]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment