Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ES969_RS16425 Genome accession   NZ_CP035402
Coordinates   3023576..3023716 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103576     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3018576..3028716
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES969_RS16400 (ES969_16400) yuxO 3018853..3019233 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  ES969_RS16405 (ES969_16405) comA 3019252..3019896 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ES969_RS16410 (ES969_16410) comP 3019977..3022289 (-) 2313 WP_103330147.1 sensor histidine kinase Regulator
  ES969_RS16415 (ES969_16415) comX 3022305..3022526 (-) 222 WP_014480704.1 competence pheromone ComX -
  ES969_RS16420 (ES969_16420) comQ 3022528..3023391 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  ES969_RS16425 (ES969_16425) degQ 3023576..3023716 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ES969_RS16430 (ES969_16430) - 3023938..3024063 (+) 126 WP_003228793.1 hypothetical protein -
  ES969_RS16435 (ES969_16435) - 3024178..3024546 (+) 369 WP_046381300.1 hypothetical protein -
  ES969_RS16440 (ES969_16440) pdeH 3024522..3025751 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  ES969_RS16445 (ES969_16445) pncB 3025887..3027359 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ES969_RS16450 (ES969_16450) pncA 3027375..3027926 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  ES969_RS16455 (ES969_16455) yueI 3028023..3028421 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=299690 ES969_RS16425 WP_003220708.1 3023576..3023716(-) (degQ) [Bacillus subtilis strain SRCM103576]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=299690 ES969_RS16425 WP_003220708.1 3023576..3023716(-) (degQ) [Bacillus subtilis strain SRCM103576]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1