Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ETA18_RS16360 Genome accession   NZ_CP035400
Coordinates   3125032..3125172 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103835     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3120032..3130172
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA18_RS16335 (ETA18_16335) yuxO 3120345..3120725 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ETA18_RS16340 (ETA18_16340) comA 3120744..3121388 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ETA18_RS16345 (ETA18_16345) comP 3121469..3123778 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  ETA18_RS16350 (ETA18_16350) comX 3123793..3123960 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ETA18_RS16355 (ETA18_16355) comQ 3123948..3124847 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ETA18_RS16360 (ETA18_16360) degQ 3125032..3125172 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ETA18_RS16365 (ETA18_16365) - 3125394..3125519 (+) 126 WP_003228793.1 hypothetical protein -
  ETA18_RS16370 (ETA18_16370) - 3125633..3126001 (+) 369 WP_128993338.1 hypothetical protein -
  ETA18_RS16375 (ETA18_16375) pdeH 3125977..3127206 (-) 1230 WP_128993339.1 cyclic di-GMP phosphodiesterase -
  ETA18_RS16380 (ETA18_16380) pncB 3127343..3128815 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ETA18_RS16385 (ETA18_16385) pncA 3128831..3129382 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  ETA18_RS16390 (ETA18_16390) yueI 3129479..3129877 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=299389 ETA18_RS16360 WP_003220708.1 3125032..3125172(-) (degQ) [Bacillus subtilis strain SRCM103835]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=299389 ETA18_RS16360 WP_003220708.1 3125032..3125172(-) (degQ) [Bacillus subtilis strain SRCM103835]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1