Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DPV67_RS11295 | Genome accession | NZ_CP030106 |
| Coordinates | 2315449..2315802 (+) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain DA33382 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2286832..2318168 | 2315449..2315802 | within | 0 |
Gene organization within MGE regions
Location: 2286832..2318168
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DPV67_RS11100 (DPV67_11095) | - | 2286832..2287830 (-) | 999 | WP_001284079.1 | phage portal protein | - |
| DPV67_RS11105 (DPV67_11100) | - | 2287830..2289617 (-) | 1788 | WP_031946558.1 | terminase large subunit domain-containing protein | - |
| DPV67_RS11110 (DPV67_11105) | - | 2289776..2290603 (+) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| DPV67_RS11115 (DPV67_11110) | - | 2290656..2291645 (+) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| DPV67_RS11120 (DPV67_11115) | gpM | 2291656..2292402 (+) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| DPV67_RS11125 (DPV67_11120) | - | 2292506..2292958 (+) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| DPV67_RS11130 (DPV67_11125) | - | 2292959..2293168 (+) | 210 | WP_000659474.1 | tail protein X | - |
| DPV67_RS11135 (DPV67_11130) | - | 2293177..2293527 (+) | 351 | WP_001114936.1 | putative holin | - |
| DPV67_RS11140 (DPV67_11135) | - | 2293524..2293793 (+) | 270 | WP_000571491.1 | phage holin family protein | - |
| DPV67_RS11145 (DPV67_11140) | - | 2293790..2294620 (+) | 831 | WP_000600982.1 | N-acetylmuramidase domain-containing protein | - |
| DPV67_RS11150 (DPV67_11145) | - | 2294617..2295144 (+) | 528 | WP_000742888.1 | phage tail protein | - |
| DPV67_RS11155 (DPV67_11150) | - | 2295141..2295590 (+) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| DPV67_RS11160 (DPV67_11155) | - | 2295663..2296295 (+) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| DPV67_RS11165 (DPV67_11160) | - | 2296292..2296639 (+) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| DPV67_RS11170 (DPV67_11165) | - | 2296636..2297538 (+) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| DPV67_RS11175 (DPV67_11170) | - | 2297538..2298143 (+) | 606 | WP_001050805.1 | phage tail protein I | - |
| DPV67_RS11180 (DPV67_11175) | - | 2298155..2300107 (+) | 1953 | WP_000729646.1 | phage tail protein | - |
| DPV67_RS11185 (DPV67_11180) | - | 2300257..2301432 (+) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| DPV67_RS11190 (DPV67_11185) | - | 2301445..2301963 (+) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| DPV67_RS11195 (DPV67_11190) | - | 2302030..2302371 (+) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| DPV67_RS11200 (DPV67_11195) | - | 2302416..2302511 (+) | 96 | WP_236085181.1 | GpE family phage tail protein | - |
| DPV67_RS11205 (DPV67_11200) | - | 2302525..2304975 (+) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| DPV67_RS11210 (DPV67_11205) | - | 2304981..2305421 (+) | 441 | WP_000979757.1 | phage tail protein | - |
| DPV67_RS11215 (DPV67_11210) | - | 2305422..2306735 (+) | 1314 | WP_072292267.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| DPV67_RS11220 (DPV67_11215) | - | 2306865..2307104 (+) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| DPV67_RS11225 (DPV67_11220) | - | 2307101..2307301 (+) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| DPV67_RS11235 (DPV67_11230) | - | 2307617..2307898 (-) | 282 | WP_000713873.1 | hypothetical protein | - |
| DPV67_RS11240 (DPV67_11235) | - | 2307898..2308776 (-) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| DPV67_RS11250 (DPV67_11245) | - | 2309086..2309280 (+) | 195 | WP_000696053.1 | hypothetical protein | - |
| DPV67_RS11255 (DPV67_11250) | - | 2309388..2310203 (+) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| DPV67_RS11260 (DPV67_11255) | - | 2310328..2310543 (+) | 216 | WP_000556351.1 | hypothetical protein | - |
| DPV67_RS11265 (DPV67_11260) | - | 2310588..2310929 (-) | 342 | WP_000786719.1 | helix-turn-helix domain-containing protein | - |
| DPV67_RS11270 (DPV67_11265) | - | 2311022..2311213 (+) | 192 | WP_001043481.1 | hypothetical protein | - |
| DPV67_RS11275 (DPV67_11270) | - | 2311307..2314045 (+) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| DPV67_RS11280 (DPV67_11275) | - | 2314042..2314374 (+) | 333 | WP_000632296.1 | hypothetical protein | - |
| DPV67_RS11285 (DPV67_11280) | - | 2314440..2314991 (+) | 552 | WP_001178668.1 | hypothetical protein | - |
| DPV67_RS19915 | - | 2314981..2315151 (+) | 171 | WP_001015076.1 | hypothetical protein | - |
| DPV67_RS11290 (DPV67_11285) | - | 2315144..2315461 (+) | 318 | WP_000049658.1 | hypothetical protein | - |
| DPV67_RS11295 (DPV67_11290) | ssb | 2315449..2315802 (+) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| DPV67_RS11300 (DPV67_11295) | - | 2315812..2316549 (+) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| DPV67_RS11305 (DPV67_11300) | - | 2316559..2316780 (+) | 222 | WP_000424605.1 | hypothetical protein | - |
| DPV67_RS11310 (DPV67_11305) | - | 2316777..2317073 (+) | 297 | WP_000218943.1 | hypothetical protein | - |
| DPV67_RS11315 (DPV67_11310) | - | 2317101..2318168 (-) | 1068 | WP_000107854.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=299256 DPV67_RS11295 WP_002014678.1 2315449..2315802(+) (ssb) [Acinetobacter baumannii strain DA33382]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=299256 DPV67_RS11295 WP_002014678.1 2315449..2315802(+) (ssb) [Acinetobacter baumannii strain DA33382]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |