Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   DOU34_RS13775 Genome accession   NZ_CP030097
Coordinates   2796777..2796917 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain SH-B74     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2791777..2801917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DOU34_RS13750 - 2792117..2792500 (-) 384 WP_061047114.1 hotdog fold thioesterase -
  DOU34_RS13755 comA 2792522..2793166 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  DOU34_RS13760 comP 2793247..2795538 (-) 2292 WP_042635452.1 histidine kinase Regulator
  DOU34_RS13765 comX 2795550..2795714 (-) 165 WP_007613432.1 competence pheromone ComX -
  DOU34_RS13770 - 2795714..2796625 (-) 912 WP_079891433.1 polyprenyl synthetase family protein -
  DOU34_RS13775 degQ 2796777..2796917 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DOU34_RS13785 - 2797380..2797721 (+) 342 WP_007408677.1 hypothetical protein -
  DOU34_RS13790 - 2797728..2798951 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  DOU34_RS13795 - 2799081..2800547 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  DOU34_RS13800 - 2800565..2801116 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  DOU34_RS13805 - 2801213..2801611 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=299139 DOU34_RS13775 WP_003152043.1 2796777..2796917(-) (degQ) [Bacillus amyloliquefaciens strain SH-B74]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=299139 DOU34_RS13775 WP_003152043.1 2796777..2796917(-) (degQ) [Bacillus amyloliquefaciens strain SH-B74]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment