Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   DOU34_RS10850 Genome accession   NZ_CP030097
Coordinates   2245903..2246169 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain SH-B74     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2240903..2251169
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DOU34_RS10800 sinR 2241067..2241402 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DOU34_RS10805 - 2241450..2242235 (-) 786 WP_007408329.1 TasA family protein -
  DOU34_RS10810 - 2242300..2242884 (-) 585 WP_007408328.1 signal peptidase I -
  DOU34_RS10815 tapA 2242856..2243527 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  DOU34_RS10820 - 2243786..2244115 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  DOU34_RS10825 - 2244155..2244334 (-) 180 WP_003153093.1 YqzE family protein -
  DOU34_RS10830 comGG 2244391..2244768 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  DOU34_RS10835 comGF 2244769..2245269 (-) 501 WP_257645080.1 competence type IV pilus minor pilin ComGF -
  DOU34_RS10840 comGE 2245178..2245492 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  DOU34_RS10845 comGD 2245476..2245913 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  DOU34_RS10850 comGC 2245903..2246169 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  DOU34_RS10855 comGB 2246216..2247253 (-) 1038 WP_061046620.1 competence type IV pilus assembly protein ComGB Machinery gene
  DOU34_RS10860 comGA 2247240..2248310 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  DOU34_RS10865 - 2248502..2249452 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  DOU34_RS10870 - 2249598..2250899 (+) 1302 WP_020956081.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=299122 DOU34_RS10850 WP_042635730.1 2245903..2246169(-) (comGC) [Bacillus amyloliquefaciens strain SH-B74]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=299122 DOU34_RS10850 WP_042635730.1 2245903..2246169(-) (comGC) [Bacillus amyloliquefaciens strain SH-B74]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment