Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   DOU34_RS10795 Genome accession   NZ_CP030097
Coordinates   2240860..2241033 (+) Length   57 a.a.
NCBI ID   WP_061046621.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain SH-B74     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2235860..2246033
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DOU34_RS10780 gcvT 2236673..2237773 (-) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -
  DOU34_RS10785 - 2238197..2239867 (+) 1671 WP_007408331.1 SNF2-related protein -
  DOU34_RS10790 - 2239889..2240683 (+) 795 WP_007408330.1 YqhG family protein -
  DOU34_RS10795 sinI 2240860..2241033 (+) 174 WP_061046621.1 anti-repressor SinI family protein Regulator
  DOU34_RS10800 sinR 2241067..2241402 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DOU34_RS10805 - 2241450..2242235 (-) 786 WP_007408329.1 TasA family protein -
  DOU34_RS10810 - 2242300..2242884 (-) 585 WP_007408328.1 signal peptidase I -
  DOU34_RS10815 tapA 2242856..2243527 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  DOU34_RS10820 - 2243786..2244115 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  DOU34_RS10825 - 2244155..2244334 (-) 180 WP_003153093.1 YqzE family protein -
  DOU34_RS10830 comGG 2244391..2244768 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  DOU34_RS10835 comGF 2244769..2245269 (-) 501 WP_257645080.1 competence type IV pilus minor pilin ComGF -
  DOU34_RS10840 comGE 2245178..2245492 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  DOU34_RS10845 comGD 2245476..2245913 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6692.70 Da        Isoelectric Point: 10.1505

>NTDB_id=299118 DOU34_RS10795 WP_061046621.1 2240860..2241033(+) (sinI) [Bacillus amyloliquefaciens strain SH-B74]
MKNAKKEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=299118 DOU34_RS10795 WP_061046621.1 2240860..2241033(+) (sinI) [Bacillus amyloliquefaciens strain SH-B74]
ATGAAAAATGCAAAAAAGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment