Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DOU34_RS10795 | Genome accession | NZ_CP030097 |
| Coordinates | 2240860..2241033 (+) | Length | 57 a.a. |
| NCBI ID | WP_061046621.1 | Uniprot ID | - |
| Organism | Bacillus amyloliquefaciens strain SH-B74 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2235860..2246033
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DOU34_RS10780 | gcvT | 2236673..2237773 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DOU34_RS10785 | - | 2238197..2239867 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| DOU34_RS10790 | - | 2239889..2240683 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| DOU34_RS10795 | sinI | 2240860..2241033 (+) | 174 | WP_061046621.1 | anti-repressor SinI family protein | Regulator |
| DOU34_RS10800 | sinR | 2241067..2241402 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| DOU34_RS10805 | - | 2241450..2242235 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| DOU34_RS10810 | - | 2242300..2242884 (-) | 585 | WP_007408328.1 | signal peptidase I | - |
| DOU34_RS10815 | tapA | 2242856..2243527 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DOU34_RS10820 | - | 2243786..2244115 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| DOU34_RS10825 | - | 2244155..2244334 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| DOU34_RS10830 | comGG | 2244391..2244768 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| DOU34_RS10835 | comGF | 2244769..2245269 (-) | 501 | WP_257645080.1 | competence type IV pilus minor pilin ComGF | - |
| DOU34_RS10840 | comGE | 2245178..2245492 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| DOU34_RS10845 | comGD | 2245476..2245913 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6692.70 Da Isoelectric Point: 10.1505
>NTDB_id=299118 DOU34_RS10795 WP_061046621.1 2240860..2241033(+) (sinI) [Bacillus amyloliquefaciens strain SH-B74]
MKNAKKEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKKEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=299118 DOU34_RS10795 WP_061046621.1 2240860..2241033(+) (sinI) [Bacillus amyloliquefaciens strain SH-B74]
ATGAAAAATGCAAAAAAGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAAAGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |