Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ES968_RS16075 Genome accession   NZ_CP035395
Coordinates   3002444..3002584 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103697     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2997444..3007584
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES968_RS16050 (ES968_16050) yuxO 2997721..2998101 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  ES968_RS16055 (ES968_16055) comA 2998120..2998764 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ES968_RS16060 (ES968_16060) comP 2998845..3001157 (-) 2313 WP_103330147.1 sensor histidine kinase Regulator
  ES968_RS16065 (ES968_16065) comX 3001173..3001394 (-) 222 WP_014480704.1 competence pheromone ComX -
  ES968_RS16070 (ES968_16070) comQ 3001396..3002259 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  ES968_RS16075 (ES968_16075) degQ 3002444..3002584 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ES968_RS16080 (ES968_16080) - 3002806..3002931 (+) 126 WP_003228793.1 hypothetical protein -
  ES968_RS16085 (ES968_16085) - 3003046..3003414 (+) 369 WP_050258610.1 hypothetical protein -
  ES968_RS16090 (ES968_16090) pdeH 3003390..3004619 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  ES968_RS16095 (ES968_16095) pncB 3004755..3006227 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ES968_RS16100 (ES968_16100) pncA 3006243..3006794 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  ES968_RS16105 (ES968_16105) yueI 3006891..3007289 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=299087 ES968_RS16075 WP_003220708.1 3002444..3002584(-) (degQ) [Bacillus subtilis strain SRCM103697]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=299087 ES968_RS16075 WP_003220708.1 3002444..3002584(-) (degQ) [Bacillus subtilis strain SRCM103697]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment