Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ES968_RS12540 Genome accession   NZ_CP035395
Coordinates   2347310..2347693 (-) Length   127 a.a.
NCBI ID   WP_076458111.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103697     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2342310..2352693
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES968_RS12500 (ES968_12500) sinI 2343242..2343415 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES968_RS12505 (ES968_12505) sinR 2343449..2343784 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES968_RS12510 (ES968_12510) tasA 2343877..2344662 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ES968_RS12515 (ES968_12515) sipW 2344727..2345299 (-) 573 WP_129134142.1 signal peptidase I SipW -
  ES968_RS12520 (ES968_12520) tapA 2345283..2346044 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ES968_RS12525 (ES968_12525) yqzG 2346316..2346642 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ES968_RS12530 (ES968_12530) spoIITA 2346684..2346863 (-) 180 WP_029726723.1 YqzE family protein -
  ES968_RS12535 (ES968_12535) comGG 2346935..2347309 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ES968_RS12540 (ES968_12540) comGF 2347310..2347693 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  ES968_RS12545 (ES968_12545) comGE 2347719..2348066 (-) 348 WP_087614620.1 ComG operon protein 5 Machinery gene
  ES968_RS12550 (ES968_12550) comGD 2348050..2348481 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  ES968_RS12555 (ES968_12555) comGC 2348471..2348767 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ES968_RS12560 (ES968_12560) comGB 2348781..2349818 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  ES968_RS12565 (ES968_12565) comGA 2349805..2350875 (-) 1071 WP_129134318.1 competence protein ComGA Machinery gene
  ES968_RS12570 (ES968_12570) - 2351087..2351284 (-) 198 WP_129134319.1 hypothetical protein -
  ES968_RS12575 (ES968_12575) corA 2351286..2352239 (-) 954 WP_129134320.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14448.54 Da        Isoelectric Point: 6.2135

>NTDB_id=299055 ES968_RS12540 WP_076458111.1 2347310..2347693(-) (comGF) [Bacillus subtilis strain SRCM103697]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=299055 ES968_RS12540 WP_076458111.1 2347310..2347693(-) (comGF) [Bacillus subtilis strain SRCM103697]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.413

99.213

0.976