Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ES967_RS12305 Genome accession   NZ_CP035394
Coordinates   2398909..2399082 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM103696     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2393909..2404082
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES967_RS12290 (ES967_12290) gcvT 2394709..2395797 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  ES967_RS12295 (ES967_12295) hepAA 2396238..2397911 (+) 1674 WP_029726726.1 SNF2-related protein -
  ES967_RS12300 (ES967_12300) yqhG 2397932..2398726 (+) 795 WP_015714249.1 YqhG family protein -
  ES967_RS12305 (ES967_12305) sinI 2398909..2399082 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES967_RS12310 (ES967_12310) sinR 2399116..2399451 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES967_RS12315 (ES967_12315) tasA 2399544..2400329 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  ES967_RS12320 (ES967_12320) sipW 2400393..2400965 (-) 573 WP_072692741.1 signal peptidase I SipW -
  ES967_RS12325 (ES967_12325) tapA 2400949..2401710 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  ES967_RS12330 (ES967_12330) yqzG 2401982..2402308 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ES967_RS12335 (ES967_12335) spoIITA 2402350..2402529 (-) 180 WP_029726723.1 YqzE family protein -
  ES967_RS12340 (ES967_12340) comGG 2402601..2402975 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  ES967_RS12345 (ES967_12345) comGF 2402976..2403359 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  ES967_RS12350 (ES967_12350) comGE 2403385..2403732 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=298903 ES967_RS12305 WP_003230187.1 2398909..2399082(+) (sinI) [Bacillus subtilis strain SRCM103696]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=298903 ES967_RS12305 WP_003230187.1 2398909..2399082(+) (sinI) [Bacillus subtilis strain SRCM103696]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment