Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ES967_RS12345 Genome accession   NZ_CP035394
Coordinates   2402976..2403359 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103696     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2397976..2408359
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES967_RS12305 (ES967_12305) sinI 2398909..2399082 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES967_RS12310 (ES967_12310) sinR 2399116..2399451 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES967_RS12315 (ES967_12315) tasA 2399544..2400329 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  ES967_RS12320 (ES967_12320) sipW 2400393..2400965 (-) 573 WP_072692741.1 signal peptidase I SipW -
  ES967_RS12325 (ES967_12325) tapA 2400949..2401710 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  ES967_RS12330 (ES967_12330) yqzG 2401982..2402308 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ES967_RS12335 (ES967_12335) spoIITA 2402350..2402529 (-) 180 WP_029726723.1 YqzE family protein -
  ES967_RS12340 (ES967_12340) comGG 2402601..2402975 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  ES967_RS12345 (ES967_12345) comGF 2402976..2403359 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  ES967_RS12350 (ES967_12350) comGE 2403385..2403732 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ES967_RS12355 (ES967_12355) comGD 2403716..2404147 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  ES967_RS12360 (ES967_12360) comGC 2404137..2404433 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  ES967_RS12365 (ES967_12365) comGB 2404447..2405484 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  ES967_RS12370 (ES967_12370) comGA 2405471..2406541 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ES967_RS12375 (ES967_12375) - 2406754..2406951 (-) 198 WP_029726717.1 hypothetical protein -
  ES967_RS12380 (ES967_12380) corA 2406953..2407906 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=298906 ES967_RS12345 WP_029726721.1 2402976..2403359(-) (comGF) [Bacillus subtilis strain SRCM103696]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=298906 ES967_RS12345 WP_029726721.1 2402976..2403359(-) (comGF) [Bacillus subtilis strain SRCM103696]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969