Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ES965_RS12360 Genome accession   NZ_CP035391
Coordinates   2393700..2393873 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM103689     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2388700..2398873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES965_RS12345 (ES965_12345) gcvT 2389499..2390587 (-) 1089 WP_129092523.1 glycine cleavage system aminomethyltransferase GcvT -
  ES965_RS12350 (ES965_12350) hepAA 2391029..2392702 (+) 1674 WP_003230203.1 SNF2-related protein -
  ES965_RS12355 (ES965_12355) yqhG 2392723..2393517 (+) 795 WP_003230200.1 YqhG family protein -
  ES965_RS12360 (ES965_12360) sinI 2393700..2393873 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES965_RS12365 (ES965_12365) sinR 2393907..2394242 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES965_RS12370 (ES965_12370) tasA 2394335..2395120 (-) 786 WP_129092524.1 biofilm matrix protein TasA -
  ES965_RS12375 (ES965_12375) sipW 2395184..2395756 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ES965_RS12380 (ES965_12380) tapA 2395740..2396501 (-) 762 WP_129092525.1 amyloid fiber anchoring/assembly protein TapA -
  ES965_RS12385 (ES965_12385) yqzG 2396774..2397100 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  ES965_RS12390 (ES965_12390) spoIITA 2397142..2397321 (-) 180 WP_014480252.1 YqzE family protein -
  ES965_RS12395 (ES965_12395) comGG 2397392..2397766 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  ES965_RS12400 (ES965_12400) comGF 2397767..2398150 (-) 384 WP_129092526.1 ComG operon protein ComGF Machinery gene
  ES965_RS12405 (ES965_12405) comGE 2398176..2398523 (-) 348 WP_123373078.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=298748 ES965_RS12360 WP_003230187.1 2393700..2393873(+) (sinI) [Bacillus subtilis strain SRCM103689]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=298748 ES965_RS12360 WP_003230187.1 2393700..2393873(+) (sinI) [Bacillus subtilis strain SRCM103689]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment