Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ES965_RS12400 Genome accession   NZ_CP035391
Coordinates   2397767..2398150 (-) Length   127 a.a.
NCBI ID   WP_129092526.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103689     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2392767..2403150
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES965_RS12360 (ES965_12360) sinI 2393700..2393873 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES965_RS12365 (ES965_12365) sinR 2393907..2394242 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES965_RS12370 (ES965_12370) tasA 2394335..2395120 (-) 786 WP_129092524.1 biofilm matrix protein TasA -
  ES965_RS12375 (ES965_12375) sipW 2395184..2395756 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ES965_RS12380 (ES965_12380) tapA 2395740..2396501 (-) 762 WP_129092525.1 amyloid fiber anchoring/assembly protein TapA -
  ES965_RS12385 (ES965_12385) yqzG 2396774..2397100 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  ES965_RS12390 (ES965_12390) spoIITA 2397142..2397321 (-) 180 WP_014480252.1 YqzE family protein -
  ES965_RS12395 (ES965_12395) comGG 2397392..2397766 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  ES965_RS12400 (ES965_12400) comGF 2397767..2398150 (-) 384 WP_129092526.1 ComG operon protein ComGF Machinery gene
  ES965_RS12405 (ES965_12405) comGE 2398176..2398523 (-) 348 WP_123373078.1 ComG operon protein 5 Machinery gene
  ES965_RS12410 (ES965_12410) comGD 2398507..2398938 (-) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  ES965_RS12415 (ES965_12415) comGC 2398928..2399224 (-) 297 WP_129092527.1 comG operon protein ComGC Machinery gene
  ES965_RS12420 (ES965_12420) comGB 2399238..2400275 (-) 1038 WP_129092528.1 comG operon protein ComGB Machinery gene
  ES965_RS12425 (ES965_12425) comGA 2400262..2401332 (-) 1071 WP_024573393.1 competence protein ComGA Machinery gene
  ES965_RS12430 (ES965_12430) - 2401545..2401742 (-) 198 WP_124058597.1 hypothetical protein -
  ES965_RS12435 (ES965_12435) corA 2401744..2402697 (-) 954 WP_032677123.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14301.37 Da        Isoelectric Point: 6.4835

>NTDB_id=298751 ES965_RS12400 WP_129092526.1 2397767..2398150(-) (comGF) [Bacillus subtilis strain SRCM103689]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMVSIEQMMNECKESQAVKTAEHGSVLTCTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIQSENQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=298751 ES965_RS12400 WP_129092526.1 2397767..2398150(-) (comGF) [Bacillus subtilis strain SRCM103689]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGGTTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAACCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTCA
GAGTGAGAACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

95.276

100

0.953