Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH24_RS00470 Genome accession   NZ_CP035256
Coordinates   78811..78969 (+) Length   52 a.a.
NCBI ID   WP_001093073.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain TVO_1901930     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 73811..83969
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH24_RS00445 (EQH24_00455) - 75108..76277 (+) 1170 WP_023396089.1 pyridoxal phosphate-dependent aminotransferase -
  EQH24_RS00450 (EQH24_00460) recO 76274..77044 (+) 771 WP_023396090.1 DNA repair protein RecO Machinery gene
  EQH24_RS00455 (EQH24_00465) plsX 77041..78033 (+) 993 WP_023396091.1 phosphate acyltransferase PlsX -
  EQH24_RS00460 (EQH24_00470) - 78039..78272 (+) 234 WP_000136446.1 acyl carrier protein -
  EQH24_RS00465 (EQH24_00475) - 78309..78608 (+) 300 Protein_86 transposase family protein -
  EQH24_RS00470 (EQH24_00480) cipB 78811..78969 (+) 159 WP_001093073.1 bacteriocin class II family protein Regulator
  EQH24_RS11575 - 78972..79097 (+) 126 WP_000346297.1 PncF family bacteriocin immunity protein -
  EQH24_RS00475 (EQH24_00485) comA 79688..81841 (+) 2154 WP_000668282.1 peptide cleavage/export ABC transporter ComA Regulator
  EQH24_RS00480 (EQH24_00490) comB 81854..83203 (+) 1350 WP_000801620.1 competence pheromone export protein ComB Regulator

Sequence

Protein


Download         Length: 52 a.a.        Molecular weight: 5435.25 Da        Isoelectric Point: 4.2644

>NTDB_id=296911 EQH24_RS00470 WP_001093073.1 78811..78969(+) (cipB) [Streptococcus pneumoniae strain TVO_1901930]
MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAILGGVAYAATCWW

Nucleotide


Download         Length: 159 bp        

>NTDB_id=296911 EQH24_RS00470 WP_001093073.1 78811..78969(+) (cipB) [Streptococcus pneumoniae strain TVO_1901930]
ATGAATACAAAAAAGATGTCACAATTTGAAATTATGGATACTGAGATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGGAGATTTTGCCAAAGCAGGTGTTGGAGGAGGAGCTATACTTGGAGGTGTGGCCTATGCAGCGACATGTTGGTGGTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-51)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

44

96.154

0.423