Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EQW70_RS17085 Genome accession   NZ_CP035226
Coordinates   3219727..3219867 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103517     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3214727..3224867
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQW70_RS17060 (EQW70_17060) yuxO 3215070..3215450 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  EQW70_RS17065 (EQW70_17065) comA 3215469..3216113 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQW70_RS17070 (EQW70_17070) comP 3216194..3218494 (-) 2301 WP_088300729.1 histidine kinase Regulator
  EQW70_RS17075 (EQW70_17075) comX 3218506..3218670 (-) 165 WP_015384519.1 competence pheromone ComX -
  EQW70_RS17080 (EQW70_17080) comQ 3218683..3219543 (-) 861 WP_128740688.1 polyprenyl synthetase family protein Regulator
  EQW70_RS17085 (EQW70_17085) degQ 3219727..3219867 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQW70_RS17090 (EQW70_17090) - 3220089..3220214 (+) 126 WP_003228793.1 hypothetical protein -
  EQW70_RS17095 (EQW70_17095) - 3220328..3220696 (+) 369 WP_116315920.1 hypothetical protein -
  EQW70_RS17100 (EQW70_17100) pdeH 3220672..3221901 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  EQW70_RS17105 (EQW70_17105) pncB 3222038..3223510 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EQW70_RS17110 (EQW70_17110) pncA 3223526..3224077 (-) 552 WP_128740689.1 isochorismatase family cysteine hydrolase -
  EQW70_RS17115 (EQW70_17115) yueI 3224174..3224572 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=294282 EQW70_RS17085 WP_003220708.1 3219727..3219867(-) (degQ) [Bacillus subtilis strain SRCM103517]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=294282 EQW70_RS17085 WP_003220708.1 3219727..3219867(-) (degQ) [Bacillus subtilis strain SRCM103517]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1