Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   DL538_RS12775 Genome accession   NZ_CP029609
Coordinates   2485355..2485729 (-) Length   124 a.a.
NCBI ID   WP_029317914.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain G7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2480355..2490729
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DL538_RS12735 (DL538_12690) yqhG 2480686..2481480 (+) 795 WP_003230200.1 YqhG family protein -
  DL538_RS12740 (DL538_12695) sinI 2481663..2481836 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  DL538_RS12745 (DL538_12700) sinR 2481870..2482205 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DL538_RS12750 (DL538_12705) tasA 2482298..2483083 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  DL538_RS12755 (DL538_12710) sipW 2483148..2483720 (-) 573 WP_072692741.1 signal peptidase I SipW -
  DL538_RS12760 (DL538_12715) tapA 2483704..2484465 (-) 762 WP_131227614.1 amyloid fiber anchoring/assembly protein TapA -
  DL538_RS12765 (DL538_12720) yqzG 2484737..2485063 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DL538_RS12770 (DL538_12725) spoIITA 2485105..2485284 (-) 180 WP_072175549.1 YqzE family protein -
  DL538_RS12775 (DL538_12730) comGG 2485355..2485729 (-) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  DL538_RS12780 (DL538_12735) comGF 2485730..2486113 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  DL538_RS12785 (DL538_12740) comGE 2486139..2486486 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  DL538_RS12790 (DL538_12745) comGD 2486470..2486901 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  DL538_RS12795 (DL538_12750) comGC 2486891..2487187 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  DL538_RS12800 (DL538_12755) comGB 2487201..2488238 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  DL538_RS12805 (DL538_12760) comGA 2488225..2489295 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  DL538_RS12810 (DL538_12765) - 2489508..2489705 (-) 198 WP_014480259.1 CBS domain-containing protein -
  DL538_RS12815 (DL538_12770) corA 2489707..2490660 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14496.68 Da        Isoelectric Point: 8.7849

>NTDB_id=294131 DL538_RS12775 WP_029317914.1 2485355..2485729(-) (comGG) [Bacillus subtilis subsp. subtilis strain G7]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=294131 DL538_RS12775 WP_029317914.1 2485355..2485729(-) (comGG) [Bacillus subtilis subsp. subtilis strain G7]
ATGTATCGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96


Multiple sequence alignment