Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EQJ84_RS16040 Genome accession   NZ_CP035191
Coordinates   3086023..3086163 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM104011     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3081023..3091163
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQJ84_RS16015 (EQJ84_16015) yuxO 3081300..3081680 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  EQJ84_RS16020 (EQJ84_16020) comA 3081699..3082343 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQJ84_RS16025 (EQJ84_16025) comP 3082424..3084736 (-) 2313 WP_077671126.1 histidine kinase Regulator
  EQJ84_RS16030 (EQJ84_16030) comX 3084752..3084973 (-) 222 WP_014480704.1 competence pheromone ComX -
  EQJ84_RS16035 (EQJ84_16035) comQ 3084975..3085838 (-) 864 WP_043858576.1 polyprenyl synthetase family protein Regulator
  EQJ84_RS16040 (EQJ84_16040) degQ 3086023..3086163 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQJ84_RS21520 - 3086385..3086447 (+) 63 Protein_3083 hypothetical protein -
  EQJ84_RS16045 (EQJ84_16045) - 3086626..3086994 (+) 369 WP_041850584.1 hypothetical protein -
  EQJ84_RS16050 (EQJ84_16050) pdeH 3086970..3088199 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  EQJ84_RS16055 (EQJ84_16055) pncB 3088336..3089808 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EQJ84_RS16060 (EQJ84_16060) pncA 3089824..3090375 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  EQJ84_RS16065 (EQJ84_16065) yueI 3090472..3090870 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=294130 EQJ84_RS16040 WP_003220708.1 3086023..3086163(-) (degQ) [Bacillus subtilis strain SRCM104011]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=294130 EQJ84_RS16040 WP_003220708.1 3086023..3086163(-) (degQ) [Bacillus subtilis strain SRCM104011]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment