Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   DL538_RS06495 Genome accession   NZ_CP029609
Coordinates   1224798..1224989 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain G7     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1219798..1229989
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DL538_RS06465 (DL538_06455) argF 1220662..1221621 (+) 960 WP_014476421.1 ornithine carbamoyltransferase -
  DL538_RS06470 (DL538_06460) yjzC 1221707..1221886 (+) 180 WP_003245356.1 YjzC family protein -
  DL538_RS06475 (DL538_06465) yjzD 1221933..1222118 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  DL538_RS06480 (DL538_06470) - 1222367..1223101 (+) 735 WP_033883595.1 hypothetical protein -
  DL538_RS06485 (DL538_06475) - 1223183..1223740 (+) 558 WP_038428783.1 hypothetical protein -
  DL538_RS06490 (DL538_06480) med 1223830..1224783 (+) 954 WP_014476425.1 transcriptional regulator Med Regulator
  DL538_RS06495 (DL538_06485) comZ 1224798..1224989 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  DL538_RS06500 (DL538_06490) yjzB 1225019..1225258 (-) 240 WP_003232972.1 spore coat protein YjzB -
  DL538_RS06505 (DL538_06495) fabH 1225423..1226361 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  DL538_RS06510 (DL538_06500) fabF 1226384..1227625 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  DL538_RS06515 (DL538_06505) yjaZ 1227701..1228486 (+) 786 WP_014479439.1 DUF2268 domain-containing protein -
  DL538_RS06520 (DL538_06510) appD 1228678..1229664 (+) 987 WP_131227309.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=294110 DL538_RS06495 WP_003224559.1 1224798..1224989(+) (comZ) [Bacillus subtilis subsp. subtilis strain G7]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=294110 DL538_RS06495 WP_003224559.1 1224798..1224989(+) (comZ) [Bacillus subtilis subsp. subtilis strain G7]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment