Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EQJ84_RS12195 Genome accession   NZ_CP035191
Coordinates   2391322..2391495 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM104011     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2386322..2396495
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQJ84_RS12175 (EQJ84_12175) gcvT 2387120..2388208 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  EQJ84_RS12180 (EQJ84_12180) hepAA 2388650..2390323 (+) 1674 WP_038829735.1 SNF2-related protein -
  EQJ84_RS12185 (EQJ84_12185) yqhG 2390344..2391138 (+) 795 WP_032726154.1 YqhG family protein -
  EQJ84_RS12195 (EQJ84_12195) sinI 2391322..2391495 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  EQJ84_RS12200 (EQJ84_12200) sinR 2391529..2391864 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQJ84_RS12205 (EQJ84_12205) tasA 2391956..2392741 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  EQJ84_RS12210 (EQJ84_12210) sipW 2392806..2393378 (-) 573 WP_077671469.1 signal peptidase I SipW -
  EQJ84_RS12215 (EQJ84_12215) tapA 2393362..2394123 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  EQJ84_RS12220 (EQJ84_12220) yqzG 2394395..2394721 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQJ84_RS12225 (EQJ84_12225) spoIITA 2394763..2394942 (-) 180 WP_014480252.1 YqzE family protein -
  EQJ84_RS12230 (EQJ84_12230) comGG 2395014..2395388 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  EQJ84_RS12235 (EQJ84_12235) comGF 2395389..2395772 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  EQJ84_RS12240 (EQJ84_12240) comGE 2395798..2396145 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=294094 EQJ84_RS12195 WP_014477323.1 2391322..2391495(+) (sinI) [Bacillus subtilis strain SRCM104011]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=294094 EQJ84_RS12195 WP_014477323.1 2391322..2391495(+) (sinI) [Bacillus subtilis strain SRCM104011]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982


Multiple sequence alignment