Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EQI87_RS12690 Genome accession   NZ_CP035166
Coordinates   2439805..2439978 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM103971     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2434805..2444978
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI87_RS12675 (EQI87_12675) gcvT 2435604..2436692 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  EQI87_RS12680 (EQI87_12680) hepAA 2437134..2438807 (+) 1674 WP_003230203.1 SNF2-related protein -
  EQI87_RS12685 (EQI87_12685) yqhG 2438828..2439622 (+) 795 WP_003230200.1 YqhG family protein -
  EQI87_RS12690 (EQI87_12690) sinI 2439805..2439978 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQI87_RS12695 (EQI87_12695) sinR 2440012..2440347 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQI87_RS12700 (EQI87_12700) tasA 2440440..2441225 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  EQI87_RS12705 (EQI87_12705) sipW 2441289..2441861 (-) 573 WP_003230181.1 signal peptidase I SipW -
  EQI87_RS12710 (EQI87_12710) tapA 2441845..2442606 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  EQI87_RS12715 (EQI87_12715) yqzG 2442878..2443204 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQI87_RS12720 (EQI87_12720) spoIITA 2443246..2443425 (-) 180 WP_029726723.1 YqzE family protein -
  EQI87_RS12725 (EQI87_12725) comGG 2443497..2443871 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  EQI87_RS12730 (EQI87_12730) comGF 2443872..2444255 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  EQI87_RS12735 (EQI87_12735) comGE 2444281..2444628 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=293333 EQI87_RS12690 WP_003230187.1 2439805..2439978(+) (sinI) [Bacillus subtilis strain SRCM103971]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=293333 EQI87_RS12690 WP_003230187.1 2439805..2439978(+) (sinI) [Bacillus subtilis strain SRCM103971]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1