Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BPUM_RS14230 Genome accession   NC_009848
Coordinates   2839585..2839725 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus SAFR-032     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2834585..2844725
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BPUM_RS14205 (BPUM_2836) - 2834907..2835296 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  BPUM_RS14210 (BPUM_2837) comA 2835320..2835961 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  BPUM_RS14215 (BPUM_2838) comP 2836042..2838348 (-) 2307 WP_012011106.1 ATP-binding protein Regulator
  BPUM_RS14220 (BPUM_2839) comX 2838362..2838541 (-) 180 WP_313960228.1 competence pheromone ComX -
  BPUM_RS14225 (BPUM_2840) - 2838510..2839433 (-) 924 WP_012011108.1 polyprenyl synthetase family protein -
  BPUM_RS14230 (BPUM_2841) degQ 2839585..2839725 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BPUM_RS14235 (BPUM_2842) - 2840231..2840584 (+) 354 WP_012011109.1 hypothetical protein -
  BPUM_RS14240 (BPUM_2843) - 2840616..2841842 (-) 1227 WP_012011110.1 EAL and HDOD domain-containing protein -
  BPUM_RS14245 (BPUM_2844) - 2841982..2843451 (-) 1470 WP_012011111.1 nicotinate phosphoribosyltransferase -
  BPUM_RS14250 (BPUM_2845) - 2843469..2844020 (-) 552 WP_012011112.1 cysteine hydrolase family protein -
  BPUM_RS14255 (BPUM_2846) - 2844081..2844488 (-) 408 WP_012011113.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=29299 BPUM_RS14230 WP_003213123.1 2839585..2839725(-) (degQ) [Bacillus pumilus SAFR-032]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=29299 BPUM_RS14230 WP_003213123.1 2839585..2839725(-) (degQ) [Bacillus pumilus SAFR-032]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment