Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DKG78_RS15205 Genome accession   NZ_CP029466
Coordinates   3085373..3085513 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain HM618     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3080373..3090513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DKG78_RS15180 (DKG78_15405) - 3080700..3081083 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  DKG78_RS15185 (DKG78_15410) comA 3081105..3081749 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  DKG78_RS15190 (DKG78_15415) comP 3081830..3084136 (-) 2307 WP_192452678.1 sensor histidine kinase Regulator
  DKG78_RS15195 (DKG78_15420) comX 3084155..3084331 (-) 177 WP_015240484.1 competence pheromone ComX -
  DKG78_RS15200 (DKG78_15425) - 3084346..3085221 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  DKG78_RS15205 (DKG78_15430) degQ 3085373..3085513 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DKG78_RS15210 (DKG78_15440) - 3085979..3086320 (+) 342 WP_015418107.1 hypothetical protein -
  DKG78_RS15215 (DKG78_15445) - 3086327..3087550 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  DKG78_RS15220 (DKG78_15450) - 3087680..3089146 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  DKG78_RS15225 (DKG78_15455) - 3089164..3089715 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  DKG78_RS15230 (DKG78_15460) - 3089812..3090210 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=292835 DKG78_RS15205 WP_003152043.1 3085373..3085513(-) (degQ) [Bacillus amyloliquefaciens strain HM618]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=292835 DKG78_RS15205 WP_003152043.1 3085373..3085513(-) (degQ) [Bacillus amyloliquefaciens strain HM618]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment