Detailed information NTG0290165

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: EJ992_RS13355
• Genome accession: NZ_CP034569
• Coordinates: 2571415..2571852 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain ATCC 14580
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2566415..2576852

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EJ992_RS13305 (EJ992_13305)	sinI	2566584..2566760 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
EJ992_RS13310 (EJ992_13310)	sinR	2566794..2567129 (+)	336	WP_006637528.1	transcriptional regulator SinR	Regulator
EJ992_RS13315 (EJ992_13315)	tasA	2567234..2568028 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
EJ992_RS13320 (EJ992_13320)	sipW	2568102..2568686 (-)	585	WP_003183449.1	signal peptidase I SipW	-
EJ992_RS13325 (EJ992_13325)	tapA	2568683..2569411 (-)	729	WP_011198112.1	amyloid fiber anchoring/assembly protein TapA	-
EJ992_RS13330 (EJ992_13330)	-	2569688..2570008 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
EJ992_RS13335 (EJ992_13335)	-	2570038..2570220 (-)	183	WP_003183456.1	YqzE family protein	-
EJ992_RS13340 (EJ992_13340)	comGG	2570309..2570674 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
EJ992_RS13345 (EJ992_13345)	comGF	2570687..2571175 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
EJ992_RS13350 (EJ992_13350)	comGE	2571084..2571431 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
EJ992_RS13355 (EJ992_13355)	comGD	2571415..2571852 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
EJ992_RS13360 (EJ992_13360)	comGC	2571858..2572151 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
EJ992_RS13365 (EJ992_13365)	comGB	2572165..2573199 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
EJ992_RS13370 (EJ992_13370)	comGA	2573189..2574253 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
EJ992_RS13375 (EJ992_13375)	-	2574410..2575249 (-)	840	WP_003183480.1	STAS domain-containing protein	-
EJ992_RS13385 (EJ992_13385)	-	2575491..2575868 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
EJ992_RS13390 (EJ992_13390)	-	2576077..2576322 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=290165 EJ992_RS13355 WP_009327905.1 2571415..2571852(-) (comGD) [Bacillus licheniformis strain ATCC 14580]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=290165 EJ992_RS13355 WP_009327905.1 2571415..2571852(-) (comGD) [Bacillus licheniformis strain ATCC 14580]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393