Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAALB65_RS15410 Genome accession   NZ_CP029069
Coordinates   3087091..3087231 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain ALB65     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3082091..3092231
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAALB65_RS15385 (BAALB65_15385) - 3082388..3082771 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  BAALB65_RS15390 (BAALB65_15390) comA 3082793..3083437 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BAALB65_RS15395 (BAALB65_15395) comP 3083518..3085821 (-) 2304 WP_021495364.1 histidine kinase Regulator
  BAALB65_RS20500 (BAALB65_15400) comX 3085841..3086020 (-) 180 WP_306383677.1 competence pheromone ComX -
  BAALB65_RS15405 (BAALB65_15405) comQ 3085947..3086960 (-) 1014 WP_275425628.1 class 1 isoprenoid biosynthesis enzyme Regulator
  BAALB65_RS15410 (BAALB65_15410) degQ 3087091..3087231 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAALB65_RS15420 (BAALB65_15420) - 3087697..3088038 (+) 342 WP_015418107.1 hypothetical protein -
  BAALB65_RS15425 (BAALB65_15425) - 3088045..3089267 (-) 1223 Protein_2949 EAL and HDOD domain-containing protein -
  BAALB65_RS15430 (BAALB65_15430) - 3089397..3090863 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BAALB65_RS15435 (BAALB65_15435) - 3090881..3091432 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  BAALB65_RS15440 (BAALB65_15440) - 3091529..3091927 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=289907 BAALB65_RS15410 WP_003152043.1 3087091..3087231(-) (degQ) [Bacillus amyloliquefaciens strain ALB65]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=289907 BAALB65_RS15410 WP_003152043.1 3087091..3087231(-) (degQ) [Bacillus amyloliquefaciens strain ALB65]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment