Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | DDE72_RS01930 | Genome accession | NZ_CP029034 |
| Coordinates | 371344..371484 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain LDO2 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 366344..376484
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DDE72_RS01900 (DDE72_01900) | - | 366647..367045 (+) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
| DDE72_RS01905 (DDE72_01905) | - | 367142..367693 (+) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| DDE72_RS01910 (DDE72_01910) | - | 367711..369177 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| DDE72_RS01915 (DDE72_01915) | - | 369307..370530 (+) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| DDE72_RS01920 (DDE72_01920) | - | 370537..370878 (-) | 342 | WP_032876795.1 | hypothetical protein | - |
| DDE72_RS01930 (DDE72_01930) | degQ | 371344..371484 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| DDE72_RS01935 (DDE72_01935) | - | 371692..372552 (+) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| DDE72_RS01940 (DDE72_01940) | comX | 372521..372694 (+) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| DDE72_RS01945 (DDE72_01945) | comP | 372708..375008 (+) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| DDE72_RS01950 (DDE72_01950) | comA | 375089..375733 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| DDE72_RS01955 (DDE72_01955) | - | 375755..376138 (+) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=289477 DDE72_RS01930 WP_003152043.1 371344..371484(+) (degQ) [Bacillus velezensis strain LDO2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=289477 DDE72_RS01930 WP_003152043.1 371344..371484(+) (degQ) [Bacillus velezensis strain LDO2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |