Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   DDE72_RS01930 Genome accession   NZ_CP029034
Coordinates   371344..371484 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LDO2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 366344..376484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDE72_RS01900 (DDE72_01900) - 366647..367045 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  DDE72_RS01905 (DDE72_01905) - 367142..367693 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  DDE72_RS01910 (DDE72_01910) - 367711..369177 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  DDE72_RS01915 (DDE72_01915) - 369307..370530 (+) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  DDE72_RS01920 (DDE72_01920) - 370537..370878 (-) 342 WP_032876795.1 hypothetical protein -
  DDE72_RS01930 (DDE72_01930) degQ 371344..371484 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DDE72_RS01935 (DDE72_01935) - 371692..372552 (+) 861 WP_142925231.1 polyprenyl synthetase family protein -
  DDE72_RS01940 (DDE72_01940) comX 372521..372694 (+) 174 WP_012118314.1 competence pheromone ComX -
  DDE72_RS01945 (DDE72_01945) comP 372708..375008 (+) 2301 WP_032876801.1 histidine kinase Regulator
  DDE72_RS01950 (DDE72_01950) comA 375089..375733 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  DDE72_RS01955 (DDE72_01955) - 375755..376138 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=289477 DDE72_RS01930 WP_003152043.1 371344..371484(+) (degQ) [Bacillus velezensis strain LDO2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=289477 DDE72_RS01930 WP_003152043.1 371344..371484(+) (degQ) [Bacillus velezensis strain LDO2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment