Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   DBK22_RS17210 Genome accession   NZ_CP028961
Coordinates   3500737..3500856 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102752     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3495737..3505856
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DBK22_RS17195 (DBK22_03456) - 3497349..3498032 (+) 684 WP_160242544.1 response regulator transcription factor -
  DBK22_RS17200 (DBK22_03457) - 3498019..3499452 (+) 1434 WP_162992601.1 sensor histidine kinase -
  DBK22_RS17205 (DBK22_03458) rapC 3499605..3500753 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  DBK22_RS17210 (DBK22_03459) phrC 3500737..3500856 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  DBK22_RS17215 - 3501005..3501115 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  DBK22_RS17220 (DBK22_03461) - 3501195..3502559 (-) 1365 WP_020955323.1 aspartate kinase -
  DBK22_RS17225 (DBK22_03462) ceuB 3502973..3503926 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  DBK22_RS17230 (DBK22_03463) - 3503916..3504863 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  DBK22_RS17235 (DBK22_03464) - 3504857..3505615 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=289027 DBK22_RS17210 WP_033575081.1 3500737..3500856(+) (phrC) [Bacillus velezensis strain SRCM102752]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=289027 DBK22_RS17210 WP_033575081.1 3500737..3500856(+) (phrC) [Bacillus velezensis strain SRCM102752]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment