Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   DBK22_RS07565 Genome accession   NZ_CP028961
Coordinates   1575294..1575560 (-) Length   88 a.a.
NCBI ID   WP_236659163.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102752     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1570294..1580560
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DBK22_RS07515 (DBK22_01519) sinR 1570458..1570793 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DBK22_RS07520 (DBK22_01520) tasA 1570841..1571626 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  DBK22_RS07525 (DBK22_01521) sipW 1571691..1572275 (-) 585 WP_012117977.1 signal peptidase I SipW -
  DBK22_RS07530 (DBK22_01522) tapA 1572247..1572918 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  DBK22_RS07535 (DBK22_01523) - 1573177..1573506 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  DBK22_RS07540 (DBK22_01524) - 1573545..1573724 (-) 180 WP_003153093.1 YqzE family protein -
  DBK22_RS07545 comGG 1573781..1574159 (-) 379 Protein_1504 competence type IV pilus minor pilin ComGG -
  DBK22_RS07550 (DBK22_01525) comGF 1574160..1574660 (-) 501 WP_268892471.1 competence type IV pilus minor pilin ComGF -
  DBK22_RS07555 (DBK22_01526) comGE 1574569..1574883 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  DBK22_RS07560 (DBK22_01527) comGD 1574867..1575304 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  DBK22_RS07565 (DBK22_01528) comGC 1575294..1575560 (-) 267 WP_236659163.1 competence type IV pilus major pilin ComGC Machinery gene
  DBK22_RS07570 (DBK22_01529) comGB 1575607..1576644 (-) 1038 WP_085342190.1 competence type IV pilus assembly protein ComGB Machinery gene
  DBK22_RS07575 (DBK22_01530) comGA 1576631..1577701 (-) 1071 WP_085342191.1 competence type IV pilus ATPase ComGA Machinery gene
  DBK22_RS07580 (DBK22_01531) - 1577898..1578848 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  DBK22_RS07585 (DBK22_01532) - 1578994..1580295 (+) 1302 WP_160242149.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9661.28 Da        Isoelectric Point: 6.2000

>NTDB_id=288985 DBK22_RS07565 WP_236659163.1 1575294..1575560(-) (comGC) [Bacillus velezensis strain SRCM102752]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTACEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=288985 DBK22_RS07565 WP_236659163.1 1575294..1575560(-) (comGC) [Bacillus velezensis strain SRCM102752]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTGCGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602

Multiple sequence alignment