Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   RBAM_RS11615 Genome accession   NC_009725
Coordinates   2429373..2429750 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis FZB42     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2424373..2434750
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RBAM_RS11575 (RBAM_022910) - 2424871..2425665 (+) 795 WP_012117976.1 YqhG family protein -
  RBAM_RS11580 (RBAM_022920) sinI 2425842..2426015 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  RBAM_RS11585 (RBAM_022930) sinR 2426049..2426384 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RBAM_RS11590 (RBAM_022940) tasA 2426432..2427217 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  RBAM_RS11595 (RBAM_022950) sipW 2427282..2427866 (-) 585 WP_012117977.1 signal peptidase I SipW -
  RBAM_RS11600 (RBAM_022960) tapA 2427838..2428509 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  RBAM_RS11605 (RBAM_022970) - 2428768..2429097 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  RBAM_RS11610 (RBAM_022980) - 2429137..2429316 (-) 180 WP_003153093.1 YqzE family protein -
  RBAM_RS11615 (RBAM_022990) comGG 2429373..2429750 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  RBAM_RS11620 (RBAM_023000) comGF 2429751..2430251 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  RBAM_RS11625 (RBAM_023010) comGE 2430160..2430474 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  RBAM_RS11630 (RBAM_023020) comGD 2430458..2430895 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  RBAM_RS11635 (RBAM_023030) comGC 2430885..2431151 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  RBAM_RS11640 (RBAM_023040) comGB 2431198..2432235 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  RBAM_RS11645 (RBAM_023050) comGA 2432222..2433292 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  RBAM_RS11650 (RBAM_023060) - 2433489..2434439 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=28871 RBAM_RS11615 WP_012117980.1 2429373..2429750(-) (comGG) [Bacillus velezensis FZB42]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=28871 RBAM_RS11615 WP_012117980.1 2429373..2429750(-) (comGG) [Bacillus velezensis FZB42]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment