Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   RBAM_RS11580 Genome accession   NC_009725
Coordinates   2425842..2426015 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis FZB42     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2420842..2431015
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RBAM_RS11565 (RBAM_022890) gcvT 2421655..2422755 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  RBAM_RS11570 (RBAM_022900) - 2423179..2424849 (+) 1671 WP_012117975.1 DEAD/DEAH box helicase -
  RBAM_RS11575 (RBAM_022910) - 2424871..2425665 (+) 795 WP_012117976.1 YqhG family protein -
  RBAM_RS11580 (RBAM_022920) sinI 2425842..2426015 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  RBAM_RS11585 (RBAM_022930) sinR 2426049..2426384 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RBAM_RS11590 (RBAM_022940) tasA 2426432..2427217 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  RBAM_RS11595 (RBAM_022950) sipW 2427282..2427866 (-) 585 WP_012117977.1 signal peptidase I SipW -
  RBAM_RS11600 (RBAM_022960) tapA 2427838..2428509 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  RBAM_RS11605 (RBAM_022970) - 2428768..2429097 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  RBAM_RS11610 (RBAM_022980) - 2429137..2429316 (-) 180 WP_003153093.1 YqzE family protein -
  RBAM_RS11615 (RBAM_022990) comGG 2429373..2429750 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  RBAM_RS11620 (RBAM_023000) comGF 2429751..2430251 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  RBAM_RS11625 (RBAM_023010) comGE 2430160..2430474 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  RBAM_RS11630 (RBAM_023020) comGD 2430458..2430895 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=28869 RBAM_RS11580 WP_003153105.1 2425842..2426015(+) (sinI) [Bacillus velezensis FZB42]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=28869 RBAM_RS11580 WP_003153105.1 2425842..2426015(+) (sinI) [Bacillus velezensis FZB42]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment