Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | RBAM_RS11580 | Genome accession | NC_009725 |
| Coordinates | 2425842..2426015 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis FZB42 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2420842..2431015
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RBAM_RS11565 (RBAM_022890) | gcvT | 2421655..2422755 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RBAM_RS11570 (RBAM_022900) | - | 2423179..2424849 (+) | 1671 | WP_012117975.1 | DEAD/DEAH box helicase | - |
| RBAM_RS11575 (RBAM_022910) | - | 2424871..2425665 (+) | 795 | WP_012117976.1 | YqhG family protein | - |
| RBAM_RS11580 (RBAM_022920) | sinI | 2425842..2426015 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| RBAM_RS11585 (RBAM_022930) | sinR | 2426049..2426384 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| RBAM_RS11590 (RBAM_022940) | tasA | 2426432..2427217 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| RBAM_RS11595 (RBAM_022950) | sipW | 2427282..2427866 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| RBAM_RS11600 (RBAM_022960) | tapA | 2427838..2428509 (-) | 672 | WP_012117978.1 | amyloid fiber anchoring/assembly protein TapA | - |
| RBAM_RS11605 (RBAM_022970) | - | 2428768..2429097 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| RBAM_RS11610 (RBAM_022980) | - | 2429137..2429316 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| RBAM_RS11615 (RBAM_022990) | comGG | 2429373..2429750 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| RBAM_RS11620 (RBAM_023000) | comGF | 2429751..2430251 (-) | 501 | WP_012117981.1 | competence type IV pilus minor pilin ComGF | - |
| RBAM_RS11625 (RBAM_023010) | comGE | 2430160..2430474 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| RBAM_RS11630 (RBAM_023020) | comGD | 2430458..2430895 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=28869 RBAM_RS11580 WP_003153105.1 2425842..2426015(+) (sinI) [Bacillus velezensis FZB42]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=28869 RBAM_RS11580 WP_003153105.1 2425842..2426015(+) (sinI) [Bacillus velezensis FZB42]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |