Detailed information
Bioinformatically predicted
Overview
| Name | CJE1441 | Type | Regulator |
| Locus tag | CJ12567_RS06415 | Genome accession | NZ_CP028909 |
| Coordinates | 1228826..1229479 (+) | Length | 217 a.a. |
| NCBI ID | WP_019109051.1 | Uniprot ID | - |
| Organism | Campylobacter jejuni strain 12567 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1209463..1264927 | 1228826..1229479 | within | 0 |
Gene organization within MGE regions
Location: 1209463..1264927
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CJ12567_RS06265 (CJ12567_1214) | - | 1209463..1210656 (-) | 1194 | WP_002853860.1 | M23 family metallopeptidase | - |
| CJ12567_RS06270 (CJ12567_1215) | - | 1210653..1211459 (-) | 807 | WP_002853622.1 | FtsX-like permease family protein | - |
| CJ12567_RS06275 (CJ12567_1216) | - | 1211446..1212111 (-) | 666 | WP_002853534.1 | ABC transporter ATP-binding protein | - |
| CJ12567_RS06280 (CJ12567_1217) | trmB | 1212181..1213359 (-) | 1179 | WP_002858203.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
| CJ12567_RS06285 (CJ12567_1218) | - | 1213359..1214594 (-) | 1236 | WP_010891920.1 | fibronectin type III domain-containing protein | - |
| CJ12567_RS06290 (CJ12567_1219) | - | 1214539..1215507 (-) | 969 | WP_002858282.1 | RluA family pseudouridine synthase | - |
| CJ12567_RS06295 (CJ12567_1220) | mrdB | 1215585..1216685 (+) | 1101 | WP_002864601.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| CJ12567_RS06305 (CJ12567_1222) | - | 1217024..1218199 (+) | 1176 | WP_002787311.1 | site-specific integrase | - |
| CJ12567_RS06310 (CJ12567_1223) | - | 1218196..1218402 (-) | 207 | WP_002787309.1 | helix-turn-helix domain-containing protein | - |
| CJ12567_RS06315 (CJ12567_1224) | - | 1218404..1218757 (-) | 354 | WP_002787307.1 | hypothetical protein | - |
| CJ12567_RS06320 (CJ12567_1225) | - | 1218775..1219530 (-) | 756 | WP_002787306.1 | site-specific DNA-methyltransferase | - |
| CJ12567_RS06325 (CJ12567_1226) | - | 1219508..1219774 (-) | 267 | WP_002787304.1 | hypothetical protein | - |
| CJ12567_RS06330 (CJ12567_1227) | - | 1219758..1220129 (-) | 372 | WP_002858334.1 | hypothetical protein | - |
| CJ12567_RS06335 (CJ12567_1228) | - | 1220130..1220354 (-) | 225 | WP_002787300.1 | hypothetical protein | - |
| CJ12567_RS06340 (CJ12567_1229) | - | 1220363..1221124 (-) | 762 | WP_002787298.1 | hypothetical protein | - |
| CJ12567_RS06345 (CJ12567_1230) | - | 1221061..1221375 (-) | 315 | WP_002787295.1 | hypothetical protein | - |
| CJ12567_RS06350 (CJ12567_1231) | - | 1221454..1221774 (-) | 321 | WP_002787293.1 | hypothetical protein | - |
| CJ12567_RS06355 (CJ12567_1232) | - | 1222162..1222398 (-) | 237 | WP_002787289.1 | hypothetical protein | - |
| CJ12567_RS06360 (CJ12567_1233) | - | 1222412..1223179 (-) | 768 | WP_002787287.1 | hypothetical protein | - |
| CJ12567_RS06365 (CJ12567_1234) | - | 1223317..1223547 (-) | 231 | WP_002787283.1 | hypothetical protein | - |
| CJ12567_RS06370 (CJ12567_1235) | - | 1223513..1223776 (-) | 264 | WP_002787281.1 | hypothetical protein | - |
| CJ12567_RS06375 (CJ12567_1236) | - | 1223833..1224120 (-) | 288 | WP_002787279.1 | YopX family protein | - |
| CJ12567_RS06380 (CJ12567_1237) | - | 1224173..1224904 (-) | 732 | WP_002801548.1 | phage regulatory protein/antirepressor Ant | - |
| CJ12567_RS06385 (CJ12567_1238) | - | 1225335..1225619 (-) | 285 | WP_002788580.1 | hypothetical protein | - |
| CJ12567_RS06390 (CJ12567_1239) | - | 1225616..1225819 (-) | 204 | WP_002858450.1 | hypothetical protein | - |
| CJ12567_RS06395 (CJ12567_1240) | - | 1226023..1226676 (+) | 654 | WP_019108959.1 | hypothetical protein | - |
| CJ12567_RS06400 (CJ12567_1241) | - | 1226911..1227573 (+) | 663 | WP_019108958.1 | S24/S26 family peptidase | - |
| CJ12567_RS06405 (CJ12567_1242) | - | 1227770..1228009 (+) | 240 | WP_019108957.1 | hypothetical protein | - |
| CJ12567_RS06410 (CJ12567_1243) | - | 1227999..1228820 (+) | 822 | WP_052774273.1 | hypothetical protein | - |
| CJ12567_RS06415 (CJ12567_1244) | CJE1441 | 1228826..1229479 (+) | 654 | WP_019109051.1 | DNA/RNA non-specific endonuclease | Regulator |
| CJ12567_RS06420 (CJ12567_1245) | - | 1229496..1229777 (+) | 282 | WP_002870263.1 | PLDc N-terminal domain-containing protein | - |
| CJ12567_RS06425 | - | 1229791..1229988 (-) | 198 | WP_002870262.1 | hypothetical protein | - |
| CJ12567_RS06430 (CJ12567_1246) | - | 1229906..1230325 (-) | 420 | WP_002857883.1 | hypothetical protein | - |
| CJ12567_RS06435 (CJ12567_1247) | - | 1230387..1230845 (-) | 459 | WP_002858146.1 | DUF5675 family protein | - |
| CJ12567_RS06440 (CJ12567_1248) | - | 1230894..1232177 (-) | 1284 | WP_052778303.1 | hypothetical protein | - |
| CJ12567_RS06445 (CJ12567_1249) | - | 1232174..1232545 (-) | 372 | WP_002801918.1 | DUF1353 domain-containing protein | - |
| CJ12567_RS06450 (CJ12567_1250) | - | 1232535..1232999 (-) | 465 | WP_002801917.1 | hypothetical protein | - |
| CJ12567_RS06455 (CJ12567_1251) | - | 1232996..1233631 (-) | 636 | WP_002789149.1 | DUF4376 domain-containing protein | - |
| CJ12567_RS06460 (CJ12567_1252) | - | 1233644..1234093 (-) | 450 | WP_002896804.1 | hypothetical protein | - |
| CJ12567_RS06465 (CJ12567_1253) | - | 1234095..1235660 (-) | 1566 | WP_052778302.1 | hypothetical protein | - |
| CJ12567_RS06470 (CJ12567_1254) | - | 1235653..1236285 (-) | 633 | WP_002788297.1 | hypothetical protein | - |
| CJ12567_RS06475 (CJ12567_1255) | - | 1236282..1236599 (-) | 318 | WP_002788295.1 | head-tail adaptor protein | - |
| CJ12567_RS06480 (CJ12567_1256) | - | 1236612..1237049 (-) | 438 | WP_002788293.1 | phage gp6-like head-tail connector protein | - |
| CJ12567_RS06485 (CJ12567_1257) | - | 1237046..1237297 (-) | 252 | WP_002788291.1 | hypothetical protein | - |
| CJ12567_RS06490 (CJ12567_1258) | - | 1237308..1238474 (-) | 1167 | WP_002788288.1 | phage major capsid protein | - |
| CJ12567_RS06495 (CJ12567_1259) | - | 1238491..1239048 (-) | 558 | WP_002788287.1 | HK97 family phage prohead protease | - |
| CJ12567_RS06500 (CJ12567_1260) | - | 1239134..1240003 (-) | 870 | WP_002788286.1 | hypothetical protein | - |
| CJ12567_RS06505 (CJ12567_1261) | - | 1240016..1245742 (-) | 5727 | WP_002800774.1 | hypothetical protein | - |
| CJ12567_RS06510 (CJ12567_1262) | - | 1245802..1246140 (+) | 339 | WP_002788283.1 | hypothetical protein | - |
| CJ12567_RS06515 (CJ12567_1263) | - | 1246132..1246347 (-) | 216 | WP_002788282.1 | hypothetical protein | - |
| CJ12567_RS06520 (CJ12567_1264) | - | 1246428..1246784 (-) | 357 | WP_002788281.1 | hypothetical protein | - |
| CJ12567_RS06525 (CJ12567_1265) | - | 1246781..1247761 (-) | 981 | WP_002858135.1 | hypothetical protein | - |
| CJ12567_RS06530 (CJ12567_1266) | - | 1247933..1248283 (-) | 351 | WP_002788276.1 | hypothetical protein | - |
| CJ12567_RS06535 (CJ12567_1267) | - | 1248284..1248826 (-) | 543 | WP_002864096.1 | HK97 gp10 family phage protein | - |
| CJ12567_RS06540 (CJ12567_1268) | - | 1248823..1249995 (-) | 1173 | WP_052778301.1 | phage portal protein | - |
| CJ12567_RS06545 (CJ12567_1269) | - | 1250155..1250589 (-) | 435 | WP_002788265.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| CJ12567_RS06550 (CJ12567_1270) | - | 1250644..1252269 (-) | 1626 | WP_002788263.1 | terminase TerL endonuclease subunit | - |
| CJ12567_RS06555 (CJ12567_1271) | - | 1252273..1252908 (-) | 636 | WP_002788261.1 | P27 family phage terminase small subunit | - |
| CJ12567_RS06565 (CJ12567_1273) | - | 1253168..1253509 (-) | 342 | WP_002788260.1 | HNH endonuclease signature motif containing protein | - |
| CJ12567_RS06570 (CJ12567_1274) | - | 1253496..1253786 (-) | 291 | WP_002788257.1 | hypothetical protein | - |
| CJ12567_RS06580 (CJ12567_1276) | ktrB | 1254530..1255873 (+) | 1344 | WP_002864101.1 | TrkH family potassium uptake protein | - |
| CJ12567_RS06585 (CJ12567_1277) | ktrA | 1255884..1256534 (+) | 651 | WP_002853664.1 | TrkA family potassium uptake protein | - |
| CJ12567_RS06590 (CJ12567_1278) | - | 1256531..1257202 (-) | 672 | WP_002857885.1 | menaquinone biosynthetic enzyme MqnA/MqnD family protein | - |
| CJ12567_RS06595 (CJ12567_1279) | upp | 1257208..1257834 (-) | 627 | WP_002858427.1 | uracil phosphoribosyltransferase | - |
| CJ12567_RS06600 (CJ12567_1280) | - | 1257831..1259066 (-) | 1236 | WP_002854063.1 | malic enzyme-like NAD(P)-binding protein | - |
| CJ12567_RS06605 (CJ12567_1281) | gltX | 1259068..1260459 (-) | 1392 | WP_002858284.1 | glutamate--tRNA ligase | - |
| CJ12567_RS06610 (CJ12567_1282) | salC | 1260524..1261339 (+) | 816 | WP_002856474.1 | peptidylprolyl isomerase SalC | - |
| CJ12567_RS06615 (CJ12567_1283) | accC | 1261377..1262708 (-) | 1332 | WP_002858001.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| CJ12567_RS06620 (CJ12567_1284) | accB | 1262710..1263165 (-) | 456 | WP_002853623.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein | - |
| CJ12567_RS06625 (CJ12567_1285) | dcd | 1263313..1263873 (+) | 561 | WP_002854086.1 | dCTP deaminase | - |
| CJ12567_RS06630 (CJ12567_1286) | pseB | 1263923..1264927 (+) | 1005 | WP_002865680.1 | UDP-N-acetylglucosamine 4,6-dehydratase (inverting) | - |
Sequence
Protein
Download Length: 217 a.a. Molecular weight: 25719.25 Da Isoelectric Point: 9.7797
>NTDB_id=288402 CJ12567_RS06415 WP_019109051.1 1228826..1229479(+) (CJE1441) [Campylobacter jejuni strain 12567]
MKKLTILFLLATLAFADYTQYKPSEEFAKYFTKQNCSQVLDKFYYLNCYDYDYKGTKAVAYRLEAENLRGKQIKKRPRFE
DDTNIPKKYRTTWSDYKHSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRIWNKIEKRERQLALKLGSLEVL
NLINYDNNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF
MKKLTILFLLATLAFADYTQYKPSEEFAKYFTKQNCSQVLDKFYYLNCYDYDYKGTKAVAYRLEAENLRGKQIKKRPRFE
DDTNIPKKYRTTWSDYKHSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRIWNKIEKRERQLALKLGSLEVL
NLINYDNNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF
Nucleotide
Download Length: 654 bp
>NTDB_id=288402 CJ12567_RS06415 WP_019109051.1 1228826..1229479(+) (CJE1441) [Campylobacter jejuni strain 12567]
ATGAAAAAACTTACAATCTTATTCTTACTAGCAACTCTAGCTTTTGCTGATTATACACAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAACAAAATTGCTCACAAGTTTTAGACAAATTCTATTATCTAAATTGTTACGATTATGATTATA
AAGGGACAAAAGCAGTAGCTTATAGATTAGAAGCAGAAAATCTAAGAGGCAAACAAATTAAAAAGCGTCCTCGTTTTGAA
GATGATACCAATATTCCTAAAAAATACCGCACCACTTGGAGCGATTATAAGCATAGCGGTTATGATAGAGGGCATACTCT
TTCTAATGCCTCTATGAGAAAAACCACTCAAGCACAAAGAAGCACTTTTTTAATGAGCAATATCACTCCACAAAATCCAC
AAATTAACCAAAGGATTTGGAATAAGATTGAAAAACGCGAAAGACAACTAGCTTTAAAACTCGGAAGTTTAGAAGTTTTA
AATTTAATCAATTATGATAATAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA
ATGAAAAAACTTACAATCTTATTCTTACTAGCAACTCTAGCTTTTGCTGATTATACACAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAACAAAATTGCTCACAAGTTTTAGACAAATTCTATTATCTAAATTGTTACGATTATGATTATA
AAGGGACAAAAGCAGTAGCTTATAGATTAGAAGCAGAAAATCTAAGAGGCAAACAAATTAAAAAGCGTCCTCGTTTTGAA
GATGATACCAATATTCCTAAAAAATACCGCACCACTTGGAGCGATTATAAGCATAGCGGTTATGATAGAGGGCATACTCT
TTCTAATGCCTCTATGAGAAAAACCACTCAAGCACAAAGAAGCACTTTTTTAATGAGCAATATCACTCCACAAAATCCAC
AAATTAACCAAAGGATTTGGAATAAGATTGAAAAACGCGAAAGACAACTAGCTTTAAAACTCGGAAGTTTAGAAGTTTTA
AATTTAATCAATTATGATAATAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| CJE1441 | Campylobacter jejuni RM1221 |
89.862 |
100 |
0.899 |
| CJE0566 | Campylobacter jejuni RM1221 |
87.442 |
99.078 |
0.866 |