Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPG27_RS00205 Genome accession   NC_011333
Coordinates   37400..37513 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori G27     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32400..42513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPG27_RS00180 (HPG27_30) - 32453..34678 (+) 2226 WP_001051489.1 ATP-dependent Clp protease ATP-binding subunit -
  HPG27_RS00185 (HPG27_31) panD 34668..35021 (+) 354 WP_000142221.1 aspartate 1-decarboxylase -
  HPG27_RS00190 (HPG27_32) - 35024..35326 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HPG27_RS00195 (HPG27_33) - 35326..36321 (+) 996 WP_000468489.1 PDZ domain-containing protein -
  HPG27_RS00200 (HPG27_34) comB6 36329..37384 (+) 1056 WP_000786680.1 P-type conjugative transfer protein TrbL Machinery gene
  HPG27_RS00205 comB7 37400..37513 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPG27_RS00210 (HPG27_35) comB8 37510..38253 (+) 744 WP_000660512.1 virB8 family protein Machinery gene
  HPG27_RS00215 (HPG27_36) comB9 38253..39236 (+) 984 WP_012552342.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPG27_RS00220 (HPG27_37) comB10 39229..40365 (+) 1137 WP_001045858.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPG27_RS00225 (HPG27_38) - 40437..41855 (+) 1419 WP_000694877.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=28590 HPG27_RS00205 WP_001217873.1 37400..37513(+) (comB7) [Helicobacter pylori G27]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=28590 HPG27_RS00205 WP_001217873.1 37400..37513(+) (comB7) [Helicobacter pylori G27]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment