Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DA379_RS12610 Genome accession   NZ_CP028441
Coordinates   2552605..2552745 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 131-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2547605..2557745
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA379_RS12585 - 2547902..2548285 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  DA379_RS12590 comA 2548307..2548951 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  DA379_RS12595 comP 2549032..2551335 (-) 2304 WP_003152050.1 histidine kinase Regulator
  DA379_RS12600 comX 2551355..2551534 (-) 180 WP_306383677.1 competence pheromone ComX -
  DA379_RS12605 comQ 2551488..2552474 (-) 987 WP_269768356.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DA379_RS12610 degQ 2552605..2552745 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DA379_RS12615 - 2553211..2553552 (+) 342 WP_003152040.1 hypothetical protein -
  DA379_RS12620 - 2553559..2554779 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  DA379_RS12625 - 2554909..2556375 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  DA379_RS12630 - 2556393..2556944 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  DA379_RS12635 - 2557041..2557439 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=285097 DA379_RS12610 WP_003152043.1 2552605..2552745(-) (degQ) [Bacillus velezensis strain 131-4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=285097 DA379_RS12610 WP_003152043.1 2552605..2552745(-) (degQ) [Bacillus velezensis strain 131-4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment