Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   DA379_RS09635 Genome accession   NZ_CP028441
Coordinates   2002629..2002802 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 131-4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1997629..2007802
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA379_RS09620 gcvT 1998447..1999547 (-) 1101 WP_003153108.1 glycine cleavage system aminomethyltransferase GcvT -
  DA379_RS09625 - 1999970..2001640 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  DA379_RS09630 - 2001658..2002452 (+) 795 WP_003153106.1 YqhG family protein -
  DA379_RS09635 sinI 2002629..2002802 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  DA379_RS09640 sinR 2002836..2003171 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DA379_RS09645 tasA 2003219..2004004 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  DA379_RS09650 sipW 2004068..2004652 (-) 585 WP_003153100.1 signal peptidase I SipW -
  DA379_RS09655 tapA 2004624..2005295 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  DA379_RS09660 - 2005554..2005883 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DA379_RS09665 - 2005923..2006102 (-) 180 WP_003153093.1 YqzE family protein -
  DA379_RS09670 comGG 2006159..2006536 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA379_RS09675 comGF 2006537..2007037 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  DA379_RS09680 comGE 2006946..2007260 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  DA379_RS09685 comGD 2007244..2007681 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=285075 DA379_RS09635 WP_003153105.1 2002629..2002802(+) (sinI) [Bacillus velezensis strain 131-4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=285075 DA379_RS09635 WP_003153105.1 2002629..2002802(+) (sinI) [Bacillus velezensis strain 131-4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment