Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DA379_RS09635 | Genome accession | NZ_CP028441 |
| Coordinates | 2002629..2002802 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain 131-4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1997629..2007802
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DA379_RS09620 | gcvT | 1998447..1999547 (-) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DA379_RS09625 | - | 1999970..2001640 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| DA379_RS09630 | - | 2001658..2002452 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| DA379_RS09635 | sinI | 2002629..2002802 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| DA379_RS09640 | sinR | 2002836..2003171 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| DA379_RS09645 | tasA | 2003219..2004004 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| DA379_RS09650 | sipW | 2004068..2004652 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| DA379_RS09655 | tapA | 2004624..2005295 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DA379_RS09660 | - | 2005554..2005883 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| DA379_RS09665 | - | 2005923..2006102 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| DA379_RS09670 | comGG | 2006159..2006536 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| DA379_RS09675 | comGF | 2006537..2007037 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| DA379_RS09680 | comGE | 2006946..2007260 (-) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| DA379_RS09685 | comGD | 2007244..2007681 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=285075 DA379_RS09635 WP_003153105.1 2002629..2002802(+) (sinI) [Bacillus velezensis strain 131-4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=285075 DA379_RS09635 WP_003153105.1 2002629..2002802(+) (sinI) [Bacillus velezensis strain 131-4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |