Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   DA378_RS16275 Genome accession   NZ_CP028440
Coordinates   3294002..3294172 (+) Length   56 a.a.
NCBI ID   WP_003152048.1    Uniprot ID   -
Organism   Bacillus velezensis strain J7-1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3289002..3299172
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA378_RS16250 - 3289152..3290618 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  DA378_RS16255 - 3290748..3291968 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  DA378_RS16260 - 3291975..3292316 (-) 342 WP_003152040.1 hypothetical protein -
  DA378_RS16265 degQ 3292782..3292922 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DA378_RS16270 comQ 3293053..3294039 (+) 987 WP_269768356.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DA378_RS16275 comX 3294002..3294172 (+) 171 WP_003152048.1 competence pheromone ComX Regulator
  DA378_RS16280 comP 3294192..3296495 (+) 2304 WP_003152050.1 histidine kinase Regulator
  DA378_RS16285 comA 3296576..3297220 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  DA378_RS16290 - 3297242..3297625 (+) 384 WP_003152054.1 hotdog fold thioesterase -
  DA378_RS16295 mnhG 3297665..3298039 (-) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  DA378_RS16300 - 3298023..3298307 (-) 285 WP_003152057.1 Na(+)/H(+) antiporter subunit F1 -
  DA378_RS16305 - 3298307..3298783 (-) 477 WP_003152059.1 Na+/H+ antiporter subunit E -

Sequence

Protein


Download         Length: 56 a.a.        Molecular weight: 6574.54 Da        Isoelectric Point: 4.8018

>NTDB_id=285022 DA378_RS16275 WP_003152048.1 3294002..3294172(+) (comX) [Bacillus velezensis strain J7-1]
MQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 171 bp        

>NTDB_id=285022 DA378_RS16275 WP_003152048.1 3294002..3294172(+) (comX) [Bacillus velezensis strain J7-1]
ATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAGCCTTATCGG
TTATGACTCTATACAAACGCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATAAAAAATGGG
ATAATGAATAA

Domains

Predicted by InterproScan.

Bacillus competence pheromone ComX (ComX)

(1-42)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

94.643

0.5

Multiple sequence alignment