Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DA378_RS16265 Genome accession   NZ_CP028440
Coordinates   3292782..3292922 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain J7-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3287782..3297922
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA378_RS16240 - 3288088..3288486 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  DA378_RS16245 - 3288583..3289134 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  DA378_RS16250 - 3289152..3290618 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  DA378_RS16255 - 3290748..3291968 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  DA378_RS16260 - 3291975..3292316 (-) 342 WP_003152040.1 hypothetical protein -
  DA378_RS16265 degQ 3292782..3292922 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DA378_RS16270 comQ 3293053..3294039 (+) 987 WP_269768356.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DA378_RS16275 comX 3294002..3294172 (+) 171 WP_003152048.1 competence pheromone ComX Regulator
  DA378_RS16280 comP 3294192..3296495 (+) 2304 WP_003152050.1 histidine kinase Regulator
  DA378_RS16285 comA 3296576..3297220 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  DA378_RS16290 - 3297242..3297625 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=285020 DA378_RS16265 WP_003152043.1 3292782..3292922(+) (degQ) [Bacillus velezensis strain J7-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=285020 DA378_RS16265 WP_003152043.1 3292782..3292922(+) (degQ) [Bacillus velezensis strain J7-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment