Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   DA377_RS18605 Genome accession   NZ_CP028439
Coordinates   3692909..3693028 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain 8-2     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 3687909..3698028
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA377_RS18575 - 3688148..3688906 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  DA377_RS18580 - 3688900..3689847 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  DA377_RS18585 ceuB 3689837..3690790 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  DA377_RS18595 - 3691205..3692569 (+) 1365 WP_003156333.1 aspartate kinase -
  DA377_RS18600 - 3692664..3692759 (+) 96 WP_012116800.1 YjcZ family sporulation protein -
  DA377_RS18605 phrC 3692909..3693028 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  DA377_RS18610 rapC 3693012..3694160 (-) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  DA377_RS18615 - 3694313..3695746 (-) 1434 WP_162130794.1 HAMP domain-containing sensor histidine kinase -
  DA377_RS18620 - 3695733..3696416 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=284964 DA377_RS18605 WP_003156334.1 3692909..3693028(-) (phrC) [Bacillus velezensis strain 8-2]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=284964 DA377_RS18605 WP_003156334.1 3692909..3693028(-) (phrC) [Bacillus velezensis strain 8-2]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment