Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   C7M30_RS19205 Genome accession   NZ_CP028218
Coordinates   3713054..3713227 (-) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102756     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3708054..3718227
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M30_RS19160 (C7M30_03801) comGE 3708405..3708752 (+) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  C7M30_RS19165 comGF 3708778..3709161 (+) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  C7M30_RS19170 (C7M30_03803) comGG 3709162..3709536 (+) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  C7M30_RS19175 (C7M30_03804) spoIITA 3709608..3709787 (+) 180 WP_014480252.1 YqzE family protein -
  C7M30_RS19180 (C7M30_03805) yqzG 3709829..3710155 (-) 327 WP_160244873.1 YqzG/YhdC family protein -
  C7M30_RS19185 (C7M30_03806) tapA 3710427..3711188 (+) 762 WP_160244874.1 amyloid fiber anchoring/assembly protein TapA -
  C7M30_RS19190 (C7M30_03807) sipW 3711172..3711744 (+) 573 WP_160245036.1 signal peptidase I SipW -
  C7M30_RS19195 (C7M30_03808) tasA 3711808..3712593 (+) 786 WP_014477324.1 biofilm matrix protein TasA -
  C7M30_RS19200 (C7M30_03809) sinR 3712685..3713020 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M30_RS19205 (C7M30_03810) sinI 3713054..3713227 (-) 174 WP_014477323.1 anti-repressor SinI Regulator
  C7M30_RS19210 (C7M30_03811) yqhG 3713411..3714205 (-) 795 WP_160244875.1 YqhG family protein -
  C7M30_RS19215 (C7M30_03812) hepAA 3714226..3715899 (-) 1674 WP_160244876.1 SNF2-related protein -
  C7M30_RS19220 (C7M30_03813) gcvT 3716341..3717429 (+) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=283466 C7M30_RS19205 WP_014477323.1 3713054..3713227(-) (sinI) [Bacillus subtilis strain SRCM102756]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=283466 C7M30_RS19205 WP_014477323.1 3713054..3713227(-) (sinI) [Bacillus subtilis strain SRCM102756]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment